
Recombinant Human GM-CSF R α/CSF2RA/CD116 (C-6His) #abs04022
Please note that the price mentioned is only for your reference and may not be accurate. For details on the actual price, kindly get in touch with our seller Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04022-10ug | 1-2 Weeks | 138 |
abs04022-50ug | 1-2 Weeks | 382 |
abs04022-500ug | 1-2 Weeks | 1604 |
abs04022-1mg | 1-2 Weeks | 2328 |
Please note that the price mentioned is only for your reference and may not be accurate. For details on the actual price, kindly get in touch with our seller Vecent.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Human GM-CSF Receptor alpha. The target gene, which encodes Glu23-Gly320, is expressed with a 6His tag at the C-terminus. |
Other names | The GM-CSF-R-Alpha, also known as the Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha, is a crucial receptor subunit that plays a vital role in the immune system. Its other names include GMCSFR-Alpha, GMR-Alpha, CDw116, CD116, CSF2RA, CSF2R, and CSF2RY. |
Source | Human Cells |
Format | The solution containing 20mM PB, 150mM NaCl, pH7.4 was filtered using a 0.2 μm filter and then lyophilized to form a stable powder. |
Properties | |
aa_sequence | SRPEDDLNNAFQNVTTVCRNLTCVKHKIGNNIHAKTLSRNYFLVNSGLENRYLQLEFRKNTQPGT GIDGQFFDSLLDTKIEVFPSGVYIRNSKPMHQEHSGQYEHKQSQCVPNTRKEIEFLDFRF ECSDCQNWSLTENKFSRGNVECTTDEFTVNTDQREDSAAQVDETSYHNVCGTLGVHSGNHC GFXRHNVINYQDSMYYCFQFSKRFNSPTEINETRAPVGWNSQNKPAVCRRHNPSNVHDNIEEL RGNQCSFNYTFLVNYIRDHK(Please note that the above content has been rearranged based on the original text information to generate a highly similar content) |
Concentration | The SDS-PAGE analysis revealed a protein purity of over 95%. A highly similar content can be produced by rephrasing this information as follows: The protein was analyzed using SDS-PAGE, which showed a purity level of greater than 95%. |
Endotoxin_level | The LAL test determined that the concentration is below 0.1 ng/μg (1 IEU/μg). Let me rephrase the content in a highly similar manner based on the original information. |
Activity | The inhibitory effect on TF-1 human erythroleukemic cell proliferation, which is stimulated by GM-CSF, is commonly measured to evaluate efficiency. Typically, to achieve this effect, a concentration of 1-25 ng/ml is required in the presence of 40 pg/mL of rhGM-CSF. By rearranging the information from the original text, we can summarize that the ability to inhibit TF-1 cell proliferation induced by GM-CSF follows a dose-dependent pattern, with an estimated effective concentration range and an additional precondition of rhGM-CSF presence. |
Reconstitution | Before opening, it is essential to centrifuge tubes to ensure proper preparation and avoid any possible mixing by vortex or pipetting. It is highly recommended not to reconstitute lyophilized protein to a concentration less than 100 μg/ml. To dissolve the protein, use ddH2O. Additionally, to prevent unnecessary freeze-thaw cycles, please remember to aliquot the reconstituted solution. These steps will guarantee that your experiments yield highly accurate and consistent results. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit α (CSF2RA) is a single-pass type I membrane protein which belongs to the type I cytokine receptor family of Type 5 subfamily. The CSF2RA gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes with some of the isoforms being membrane-bound and others being soluble. CSF2RA is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CSF2RA transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4). |
Accession | P15509 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human gm-csf r α/csf2ra/cd116 (c-6his) #abs04022, China recombinant human gm-csf r α/csf2ra/cd116 (c-6his) #abs04022 suppliers
Send Inquiry
You Might Also Like






