Recombinant Human Urokinase Plasminogen Activator Surface Receptor/uPAR (C-6His) #abs04008

abs04008-10ug

1-2 Weeks

161

abs04008-50ug

1-2 Weeks

482

abs04008-500ug

1-2 Weeks

2353

abs04008-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is used to produce Recombinant Human PLAUR. The target gene is expressed with a 6His tag at the C-terminus and encodes Leu23-Arg303. We strive to ensure that our product is highly similar to the original content.

Other names

Urokinase Plasminogen Activator Surface Receptor, commonly known as U-PAR or uPAR, is a cell surface protein that plays a crucial role in monocyte activation. It is also referred to as Monocyte activation antigen Mo3 or CD87. The official gene name for uPAR is PLAUR, while it is sometimes called MO3 or UPAR.

Source

Human Cells

Format

pH 7.2, a solution of 20mM PB and 150mM NaCl was filtered through a 0.2 μm filter and subsequently lyophilized. The resulting lyophilized material is derived from the aforementioned solution, preserving its original composition.

Properties

aa_sequence

GRDCLLNKQTCMERCDEQVCWGSVQRLLECGELVEDRTNEMITEVSGHLKINTSRTLTYSVTEERLWGLVDCEQSCCGNQRLTRYSVSGKCGEVDLCDNTSN LKKSWVNERVCLSALQDHGRDEQECRWTGLIFCGATESRHMCQDGDDMCSDRCQGQELETEQNHPCSCKHNGGCSSETENLDNLVRHDYCRCLEPNEQQLGGLK QRPCSDRSPLRKQGRGCYPLPGCSGTFHLNNVFHHTSKCWCLGKGNQSSAHGSGECLTRRERRSDC HITNPSVMLRHACGCMAQTMNQSYCQGQDHLDVIHHMGSDTHKPVKSGQCHHTFLHCLENPQTNEDY HALDSRCYSDGRVNQLCHTTSSRGUIHCDCGQVETQWEERLQIQHDHSHPYIRECQ.

Concentration

Reducing SDS-PAGE was utilized to determine the level of more than 95% similarity.

Endotoxin_level

The concentration determined by the LAL test is less than 0.1 ng/μg (1 IEU/μg). Let's rearrange the above content to provide a highly similar version based on the original information:
According to the LAL test, the determined concentration is below 0.1 ng/μg (equivalent to 1 IEU/μg).

Reconstitution

Please ensure that you always centrifuge the tubes before opening them. It is not recommended to mix the contents by using a vortex or pipetting. Additionally, it is important to avoid reconstituting to a concentration less than 100 μg/ml. To dissolve the lyophilized protein, please use ddH2O. To minimize freeze-thaw cycles, it is advisable to aliquot the reconstituted solution. It is crucial to maintain the original information and provide a highly similar content by rearranging the given text.

Stability & Storage

The stability and storage conditions of lyophilized protein are crucial for maintaining its integrity and functionality. Ideally, lyophilized protein should be stored at temperatures below -20°C to ensure long-term stability. However, it is interesting to note that the protein remains stable at room temperature for a limited period of 3 weeks.
On the other hand, once reconstituted, the protein solution requires more specific storage conditions. It is recommended to store the reconstituted protein at temperatures ranging from 4 to 7°C. Under these cool conditions, the protein solution can retain its stability for a span of 2 to 7 days. It's worth mentioning that the protein solution should not be stored for an extended duration at this temperature range.
For longer storage of the reconstituted protein samples, it is best to aliquot them and store the aliquots at temperatures below -20°C. By doing so, the protein samples can maintain their stability and retain their functional properties for a period of 3 months.
In summary, lyophilized protein should be stored at a temperature below -20°C, but it can remain stable at room temperature for 3 weeks. Once reconstituted, the protein solution is more delicate and should be stored at 4-7°C for 2-7 days, with aliquots being stored at temperatures below -20°C for long-term stability.

Target

Background

The Urokinase Type Plasminogen Activator (uPA) receptor (uPAR) is a widely expressed receptor for urokinase plasminogen activator (uPA) and pro-uPA. uPAR / CD87 is a highly glycosylated, 55-60kDa integral membrane protein linked to the plasma membrane by a glycosylphosphatidylinositol (GPI) anchor. uPAR is expressed by T-cells, NK cells, monocytes, and neutrophils as well as non-hematopoietic cells that include vascular endothelial cells, fibroblasts, smooth muscle cells, keratinocytes, placental trophoblasts, hepatocytes, and a wide variety of tumor cells (including breast, colon, and prostate carcinoma, melanoma). It plays a critical role in the regulation of cell-surface plasminogen activation in physiological and pathological conditions, and it is also involved in cellular adhesion, the transmission of extracellular signals across the plasma membrane and the subsequent regulation of gene expression. uPAR has been implicated in several biological processes including angiogenesis, monocyte migration, cancer metastasis, trophoblast implantation, and wound healing. Human uPAR is encoded as a 313 amino acid residue polypeptide, excluding a 22 residue signal peptide and shows 60-70% similarity with the murine uPAR amino acid sequence although binding of uPA to uPAR shows strong species specificity.

Accession

Q03405