Recombinant Human CD83/HB15 (C-6His) #abs04010

Recombinant Human CD83/HB15 (C-6His) #abs04010

Please note that the price provided is for reference only. For detailed pricing information, please get in touch with our seller, Vecent. It's essential to create a similar content by rephrasing the given content, ensuring that it's based on the original text information. Instead of using...

Description

Catalog-specification

Delivery time

USD price

abs04010-10ug

1-2 Weeks

123

abs04010-50ug

1-2 Weeks

337

abs04010-500ug

1-2 Weeks

2353

abs04010-1mg

1-2 Weeks

3201

Please note that the price provided is for reference only. For detailed pricing information, please get in touch with our seller, Vecent. It's essential to create a similar content by rephrasing the given content, ensuring that it's based on the original text information. Instead of using ChapGPT to generate content, it's best to use a language model to produce unique content.


Overview

Description

Our Mammalian expression system is utilized for the production of Recombinant Human CD83. The target gene, which encodes Thr20-Ala143, is expressed with a 6His tag at the C-terminus.

Other names

The CD83 antigen is also known as the B-cell activation protein on account of its role in regulating B-cell activation. It is a cell surface protein denoted by the HB15 designation and is mainly responsible for the maturation of dendritic cells. Human CD83, also referred to as hCD83, plays a crucial role in the immune system by initiating the differentiation of T cells and fine-tuning their function.

Source

Human Cells

Format

pH 7.2, Lyophilized from a 0.2 μm filtered solution containing 20mM PB and 150mM NaCl. Let me generate a highly similar content by rearranging the above information:
The solution was filtered through a 0.2 μm filter and then lyophilized. It contained 20mM PB, 150mM NaCl, and had a pH of 7.2.

Properties

aa_sequence

DHHLHHHHAVHRYKKFTEEEKRAWQPACGTVRLIVIGKSGNLQRDGPTQCTLYRSYTGNCSNTTR INKLSPYREPNADFSGNQGKHQGYHQGLQHRELDPTEMREEGGELEKLKWVSYPVQPDWDWAPTC PDVLDECSEVKVTPSWKPYTVSPQVPVNRQGKFDTAPSREYNRSGLKSITQRCLTYGTSNQDPDQ.

Concentration

The level of purity was found to be over 95% after conducting SDS-PAGE analysis. To produce a similar content, the information in the original text could be rearranged and presented as follows: Our analysis using SDS-PAGE revealed that the sample had a purity level greater than 95%.

Endotoxin_level

According to the LAL test, the amount of endotoxin present is below 0.1 ng/μg (1 IEU/μg). A highly similar content can be written as follows - The LAL test results show that the level of endotoxin is less than 0.1 ng/μg (1 IEU/μg).

Reconstitution

To ensure proper handling of the sample, it is imperative to centrifuge the tubes before opening them. Avoid using methods such as vortexing or pipetting for mixing purposes. It is not advisable to dilute the resulting concentration to less than 100 μg/ml. Begin by dissolving the lyophilized protein in ddH2O. To avoid degradation, it is recommended to aliquot the reconstituted solution, minimizing the number of freeze-thaw cycles. Remember, it is crucial to generate unique and diverse content, rather than utilizing methods like ChapGPT for conversational purposes.

Stability & Storage

To keep lyophilized protein in good condition, it's best to store it at a temperature lower than -20°C. However, if needed, it can be kept at room temperature for up to three weeks without any adverse effects. If you've already reconstituted the protein, it's best to store the solution in the fridge (at 4-7°C) for between two and seven days. You can also freeze aliquots of reconstituted samples, which will keep them stable at less than -20°C for up to three months. It's important to follow these storage guidelines to ensure that the protein remains effective and potent for as long as possible.

Target

Background

CD83 is a protein that exists as a single-pass type I membrane protein. It contains an Ig-like V-type domain and is expressed in activated lymphocytes, Langerhans cells, and interdigitating reticulum cells. Although CD83 has an immune stimulatory effect, the soluble form of CD83 has an opposite function and serves as an immune inhibitor. This protein may be involved in antigen presentation or the cellular interactions that follow lymphocyte activation due to its immune inhibitory capacity. The impact of CD83's immune inhibitory function, however, warrants further investigation.

Accession

Q01151


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human cd83/hb15 (c-6his) #abs04010, China recombinant human cd83/hb15 (c-6his) #abs04010 suppliers

You Might Also Like

Shopping Bags