Recombinant Human OX-2/MOX1/CD200 (C-6His) #abs04003

abs04003-10ug

1-2 Weeks

123

abs04003-50ug

1-2 Weeks

337

abs04003-500ug

1-2 Weeks

2353

abs04003-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is used to produce Recombinant Human CD200. The target gene, which encodes Gln31-Gly232, is expressed with a 6His tag at the C-terminus. To create a highly similar content, I have rearranged the information while ensuring that it is based on the original text.

Other names

OX-2 Membrane Glycoprotein, CD200, MOX1, MOX2

Source

Human Cells

Format

The solution of 20mM PB, 150mM NaCl, pH 7.4 was filtered through a 0.2 μm filter and then lyophilized. Let me now create some highly similar content by rearranging the information provided above.

Properties

aa_sequence

ITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITC-QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKIN SATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDF KQTVNKGVDHHHHHH

Concentration

By utilizing SDS-PAGE reduction analysis, it has been established that the protein concentration is above 95%. Consequently, the sample exhibits an exceptional purity level.

Endotoxin_level

The LAL test determines that the level of Less than 0.1 ng/μg (1 IEU/μg) is present in the sample. Let's rearrange the content to generate a highly similar version: The determined value from the LAL test indicates that the sample contains a concentration of Less than 0.1 ng/μg (1 IEU/μg).

Reconstitution

Before opening, always remember to centrifuge the tubes. Avoid mixing the contents by using a vortex or pipetting method. It is highly advised not to reconstitute the protein to a concentration below 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. It is recommended to aliquot the reconstituted solution in order to minimize freeze-thaw cycles.

Stability & Storage

To ensure optimal preservation of lyophilized protein, it should be kept at a temperature below -20°C. However, it can also be stored at room temperature for up to three weeks without compromising its stability. On the other hand, reconstituted protein solution is best stored at 4-7°C for a maximum of 2-7 days. For long-term storage, aliquots of reconstituted samples should be kept at a temperature below -20°C for up to three months to maintain their stability.

Target

Background

CD200 belongs to the immunoglobulin superfamily and has an important role in regulating immune responses. This transmembrane protein contains an extracellular domain with one Ig like V type and one Ig like C2 type domain. Though it is widely expressed, its receptor (CD200R) is primarily found on myeloid cells like mast cells, basophils, macrophages, and dendritic cells. When CD200 binds with CD200R, it initiates inhibitory signals in myeloid cells. CD200 can also function as a co-stimulatory molecule in T cells, independent of the CD28 pathway.
Furthermore, CD200 is crucial in preventing graft rejection, autoimmune diseases, and spontaneous abortion. Its significance lies in its ability to regulate the immune system's response to self and non-self-antigens, which is crucial for maintaining immune tolerance. With its various functions, CD200 is a promising target for immunotherapy and could lead to the development of novel therapeutic approaches for various diseases.

Accession

P41217