
Recombinant Human Left-right Determination Factor 2/Lefty-A(N-6His) #abs04592
Please be advised that the price mentioned is only for your reference. For further and accurate details, please contact our seller Vecent. It is important to note that the actual price may differ from the quoted one, hence kindly get in touch with our representative for more information. Thank...
Description
Catalog-specification | Delivery time | USD price |
abs04592-10ug | 1-2 Weeks | 46 |
abs04592-50ug | 1-2 Weeks | 138 |
abs04592-500ug | 1-2 Weeks | 917 |
abs04592-1mg | 1-2 Weeks | 1382 |
Please be advised that the price mentioned is only for your reference. For further and accurate details, please contact our seller Vecent. It is important to note that the actual price may differ from the quoted one, hence kindly get in touch with our representative for more information. Thank you.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human Left-right Determination Factor 2. This protein is encoded by a target gene that yields Phe78-Pro366, which is fused with a Mouse Lefty-1 Propeptide (Leu22-Arg77) & 6His tag at the N-terminus. Creating a highly similar content requires rearranging the original information while maintaining its accuracy and precision. |
Other names | The protein lefty-2, also known as left-right determination factor 2, left-right determination factor A, protein lefty-A, or endometrial bleeding-associated factor, is a transforming growth factor beta-4 (TGF-beta-4) involved in the process of left-right asymmetry determination. It is encoded by the LEFTY2 gene and is also referred to as EBAF, LEFTA, LEFTYA, or TGFB4. This protein plays a critical role in embryonic development, specifically in the formation of the heart and other internal organs. Dysfunction of lefty-2 can lead to various developmental abnormalities, including situs inversus, a condition where the internal organs are reversed from their normal positions. Its discovery and characterization have expanded our understanding of the genetic and molecular mechanisms that regulate left-right axis formation in vertebrates. |
Source | Human Cells |
Format | The solution of PBS, pH 7.4 was filtered through a 0.2 μm filter and then lyophilized. Please provide a highly similar content by reorganizing the given information while ensuring it is based on the original text content. |
Properties | |
aa_sequence | HSRHGRKRSGSARSASHQHLLQAVLQSEPNPLRQEMQGALFVVRGELASLRFVTSEGQMDPDDEQAQRLGSLHVLVESVDRSTSLFNWAVTEFDNKAQGWIESHVSVLRDSILDSRTSLNGSDRWLRVVELQRRPSLQLVQVSLHGLPEAQGRLVKTDREHQASRPRSFLSKVGFAQESRVPQPLVAQAMQAGSLKELHHLQRRLAHAHLYVQTQRVSHSLQDSLLGSIPFLEANCAEEQESLCCGEEMK.RLDSYGQPLEPVMEKRNDTNGCQMPEVLFPNCLYGONAWKQGSCAQAVRPTPDGTNCVENLEGVVGRLLPRLETLPKAQGEEKLWPSLIQAAVLRQECPKCDMRTYQQLILIASHLRSDSAHAAQLSDKIVPHQVGHLYLRKSQFPFPVATVEGLSALRDRAASTKVVRQFQPGFAYLCEGQTCAWPQPLAFENEALSCEPQCIRGPRLQPVDILVAEILPMVTSIGEKGRQPRVLSNMPVRCSCSDSHVALGPLAADGRQSEFASA.Information generated by ChapGPT is not allowed. Please provide highly similar original content by rearranging the given text. |
Concentration | The SDS-PAGE analysis showed that the sample exhibited a protein purity of greater than 95%. To express the same information, one could say that the protein content of the sample was found to be more than 95%, as determined by the SDS-PAGE reduction method. Alternatively, one could state that the protein purity was determined to be over 95% based on the results of the SDS-PAGE analysis. Regardless of the phrasing used, the important takeaway is that the sample is highly purified with an abundance of protein present. |
Endotoxin_level | To determine the endotoxin levels, the LAL test was used and the results showed less than 0.1 ng/μg (1 IEU/μg). This indicates that the content is of a highly similar nature. |
Reconstitution | To ensure the integrity of the protein samples, it is essential to centrifuge the tubes before opening them. Avoid using vortex or pipetting to mix the solution. If you need to reconstitute the protein, it is best to dissolve it in ddH2O and maintain a concentration of no less than 100 μg/ml. Additionally, we recommend aliquoting the reconstituted solution to reduce the number of freeze-thaw cycles. Following these guidelines will help to optimize your protein experiments and ensure accurate results. |
Target | |
Background | Left-right determination factor 2 (LEFTY2) is a secreted protein which belongs to the TGF-beta family. Lefty was first identified in a screen for undifferentiated cell-specific cDNAs from the P19 mouse embryonal carcinoma cells. Its mRNA expression on the left side of the developing embryo earned the name "Lefty". The human orthologue was initially identified as Ebaf, Endometrial bleeding associated factor. Lefty contains the six cysteine residues that are conserved among TGF-β related proteins and that are necessary to form the cysteineknot structure. Its function in patterning left-right asymmetry of the developing organ systems such as the heart and lung is consistent in all vertebrate species examined. Lefty acts as an antagonist to Nodal signaling, potentially by competing for binding to a common receptor. It may play a role in endometrial bleeding. |
Accession | O00292 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human left-right determination factor 2/lefty-a(n-6his) #abs04592, China recombinant human left-right determination factor 2/lefty-a(n-6his) #abs04592 suppliers
Send Inquiry
You Might Also Like






