Recombinant Human Gankyrin/PSDM10 #abs04308

Recombinant Human Gankyrin/PSDM10 #abs04308

Please note that the price mentioned above is only for reference purposes. For detailed pricing information, kindly get in touch with our seller Vecent. It's essential to note that the final price may differ from the mentioned price. So, for accurate pricing, it's best to speak with our seller....

Description

Catalog-specification

Delivery time

USD price

abs04308-10ug

1-2 Weeks

161

abs04308-50ug

1-2 Weeks

482

abs04308-500ug

1-2 Weeks

2353

abs04308-1mg

1-2 Weeks

3201

Please note that the price mentioned above is only for reference purposes. For detailed pricing information, kindly get in touch with our seller Vecent. It's essential to note that the final price may differ from the mentioned price. So, for accurate pricing, it's best to speak with our seller.


Overview

Description

Our E.coli expression system is used to produce Recombinant Human Gankyrin, where the target gene expressing Met1-Gly226 is employed. Let me rearrange the content to generate a highly similar version while still preserving the original information.

Other names

PSMD10, also known as 26S proteasome non-ATPase regulatory subunit 10, 26S proteasome regulatory subunit p28, Gankyrin or p28 (GANK), is a protein that plays a key role in the regulation of protein degradation. It is a subunit of the 26S proteasome, which is responsible for the degradation of misfolded or damaged proteins. PSMD10 is a non-ATPase regulatory subunit that interacts with other regulatory and catalytic subunits to form the 26S proteasome complex.
PSMD10 was identified as a binding partner of the oncoprotein, HCV core protein, and its expression is upregulated in hepatocellular carcinoma (HCC). It has been shown to regulate key cancer-related pathways, such as the cyclin D-CDK4/6-Rb pathway and the p53-MDM2 axis, and thus has been implicated in the development and progression of various cancers. PSMD10 has also been linked to the regulation of apoptosis, cell cycle progression, and DNA repair.
In addition to its role in cancer, PSMD10 has been implicated in other diseases such as multiple sclerosis, Alzheimer's disease, and Parkinson's disease, where it may contribute to neurodegeneration. PSMD10 may also have a role in viral replication, as it has been shown to interact with viral proteins from various viruses, including HIV-1 and HCV.
Overall, PSMD10 is a multifunctional protein that plays a key role in protein degradation and has important implications for various diseases, including cancer and neurodegeneration. Its interactions with various proteins and pathways make it an attractive target for the development of new therapeutic strategies.

Source

Escherichia coli.

Format

pH 7.420mM PB、150mM NaCl、10%0.2μm。,。

Properties

aa_sequence

ASILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGA NPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGMEGCVSNLMVCNLAYSGKLEELKESIYIENKEEKTPLQVAKGGLGLILKRMVEG,。

Concentration

By utilizing SDS-PAGE analysis, it was found that the sample exhibited a purity greater than 95%. In order to create alternative wording while communicating the same information, a rephrasing of the original statement might be: The sample's purity was assessed through SDS-PAGE analysis which revealed a purity level of over 95%.

Endotoxin_level

The LAL test determined that the content is less than 0.1 ng/μg (1 IEU/μg). To ensure a highly similar content, the above information remains unchanged.

Stability & Storage

To maintain stability, store the product at a temperature below -20°C. It should be noted that the product is stable for only 6 months after receipt, hence minimizing freeze-thaw cycles is recommended. Please reiterate the instructions to ensure that they are appropriately followed.

Target

Background

Gankyrin is a multicatalytic proteinase oncoprotein consists of 7 ankyrin repeats. Gankyrin overexpressed in most hepatocellular carcinomas. Gankyrin is involved in theregulation of the phosphorylation of the retinoblastoma protein by CDK4 to enhance the ubiquitinylation of p53 by MDM2. Gankyrin is also involved in progression of esophageal squamous cell carcinoma. Gankyrin plays an oncogenic role especially in early stages of human epatocarcinogenesis.

Accession

O75832


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human gankyrin/psdm10 #abs04308, China recombinant human gankyrin/psdm10 #abs04308 suppliers

You Might Also Like

Shopping Bags