
Recombinant Human N-Glycosylase/OGG1 (N-GST) #abs04300
Please note that the price mentioned here is just for reference purposes only. For details regarding the exact price, please feel free to get in touch with our seller, Vecent. We would be happy to provide you with more information on this matter. Hence, kindly reach out to our representative to...
Description
Catalog-specification | Delivery time | USD price |
abs04300-10ug | 1-2 Weeks | 161 |
abs04300-50ug | 1-2 Weeks | 482 |
abs04300-500ug | 1-2 Weeks | 2353 |
abs04300-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned here is just for reference purposes only. For details regarding the exact price, please feel free to get in touch with our seller, Vecent. We would be happy to provide you with more information on this matter. Hence, kindly reach out to our representative to know more about the actual pricing and other relevant details.
Overview | |
Description | Our E.coli expression system is responsible for the production of Recombinant Human N-Glycosylase, which consists of the Met1-Gly345 gene expressed with a GST tag at the N-terminus. Our aim is to create highly similar content by rearranging the original text to provide accurate information. |
Other names | DNA repair enzymes play a crucial role in maintaining the integrity of our genetic code. One such enzyme is N-Glycosylase/DNA Lyase, which is responsible for detecting and removing damaged bases from the DNA strand. Specifically, it targets the oxidized base 8-Oxoguanine, which can result from exposure to reactive oxygen species found in our environment. |
Source | Escherichia coli. |
Format | This is a solution that has been filtered with 0.2 μm and consists of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 1mM EDTA, 50% Glycerol, with a pH of 7.8. |
Properties | |
aa_sequence | SPMILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLT QSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLK MFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSS KYIAWPLQGWQATFGGGDHPPKSDLVPRGSMPARALLPRRMGHRTLASTPALWASIPCPRSELRL DLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYF QLDVTLAQLYHHWGSVDSHFQEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAF GPRLIQLDDVTYHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRE SSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQT NKELGNFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG. |
Concentration | Based on our analysis using SDS-PAGE, we can confirm that the purity of the compound is greater than 95%. To be precise, we arrived at this conclusion by reducing the sample on the gel. |
Endotoxin_level | According to the LAL test, the level of contamination is below 0.1 ng/μg (1 IEU/μg). |
Stability & Storage | To maintain the stability of lyophilized protein, it is recommended to store it at temperatures lower than -20°C. However, if needed, it can be kept at room temperature for a maximum duration of 3 weeks. When preparing the protein solution from lyophilized form, it can be stored at temperatures between 4-7°C for a short span of 2-7 days. It's better to aliquot samples into smaller portions and freeze them at temperatures lower than -20°C for long-term storage, for up to three months. This is an easy and effective way to preserve the stability of protein samples, ensuring their usability for future research. |
Target | |
Background | Human N-Glycosylase/DNA Lyase is a DNA repair enzyme, which incises DNA at 8-oxoG residues, and excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damage DNA. DGG1 has a β-lyase activity that nicks DNA 3' to the lesion. |
Accession | O15527 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human n-glycosylase/ogg1 (n-gst) #abs04300, China recombinant human n-glycosylase/ogg1 (n-gst) #abs04300 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human Interferon Lambda-2/IL-28A(C-6His)...
-

Recombinant Human Lysosomal Pro-X Carboxypeptidase/P...
-

Rabbit Anti-Catenin-gamma Polyclonal Antibody #abs13...
-

Recombinant Mouse ICOS Ligand/B7-H2/CD275 (C-6His) #...
-

Recombinant Human Galectin-3 #abs01295
-

Mouse Anti-GAPDH Monoclonal Tag Antibody #abs830030
