
Recombinant Mouse CD28//TP44 (C-Fc-6His) #abs04037
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to emphasize that the following content will be generated by rearranging the original information and not following the...
Description
Catalog-specification | Delivery time | USD price |
abs04037-10ug | 1-2 Weeks | 46 |
abs04037-50ug | 1-2 Weeks | 123 |
abs04037-500ug | 1-2 Weeks | 619 |
abs04037-1mg | 1-2 Weeks | 801 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to emphasize that the following content will be generated by rearranging the original information and not following the conversation method used by ChapGPT.
Overview | |
Description | Our Mammalian expression system is utilized to produce Recombinant Mouse CD28, wherein the target gene that codes for Asn20-Lys149 is expressed with a Fc, 6His tag positioned at the C-terminus. |
Other names | T-cell-specific surface glycoprotein CD28,CD28 |
Source | Human Cells |
Format | The solution of 20mM PB, 150mM NaCl, pH 7.4 was filtered through a 0.2 μm filter and then lyophilized to obtain a dried form. |
Properties | |
aa_sequence | LSGNHFHFHQDKDVYENYLVKEPADPQPLHVNLAFTERTQSSKIVEMLMHDVDRSINLVHNCGESFNOETLKEDVCTSGYEDDFNFITALKQSR VPMPRQHEGSCWYPILKNSYYVFDEENVGVKVTGVLTVKWCNDTASEFQFEVTEYLRRINYTLRSHKYNKSGGPIASGGPSLDGYVKLQWMK WNTVNSHTVYDNWFDYNERFSEPCGANLDFQSCSTYMVECEFTKPQHRONNLKGSTVQIDVATFVVNPLSCGFEPLHTDPKEISGKM TVVTSHPPGPWGNQSFFNKWEYNEKDNPYKITVSKAfLKPTQFEQEYVVHLCTKCLEDLSCVDSPNNPLRQNKVRDQYQFPVSGMTPA DYYPWPLGEQNKSCPKIKRVLSHSIDFYWWQNFVITDKPWVDLGTQNKINLTYGFEAAPPLAKMTLDEHFSYURLFIKCQNEVVMRFGCCES IVFNSVGPSLNRRPEHYEKEVSQGKKGATNDISKSKCQF Ney-NNEQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSN AEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCH TQSSPKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI EVESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS S |
Concentration | SDS-PAGE,95%。,,。 |
Endotoxin_level | The LAL test confirms that the amount of endotoxin present is less than 0.1 ng per microgram or 1 International Unit per microgram. |
Reconstitution | Make sure to always centrifuge the tubes before opening to ensure optimal results. Avoid using the vortex or pipetting methods for mixing. It is highly advised not to reconstitute the protein to a concentration lower than 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. Additionally, it is important to aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Stability & Storage | For optimal storage of lyophilized protein, it is recommended to keep it at a temperature below -20°C. However, if necessary, the protein can be stored at room temperature for up to 3 weeks without losing its stability. |
Target | |
Background | T-cell-specific surface glycoprotein CD28, contains an Ig-like V-type domain. CD28 is one of the proteins expressed on T cells that provide co-stimulatory signals, which are required for their activation. It is the receptor for CD80 and CD86. When activated by Toll-like receptor ligands, the CD80 expression is upregulated in antigen presenting cells (APCs). The CD86 expression on antigen presenting cells is constitutive. CD28 is the only B7 receptor constitutively expressed on naive T cells. It involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. |
Accession | P31041 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse cd28//tp44 (c-fc-6his) #abs04037, China recombinant mouse cd28//tp44 (c-fc-6his) #abs04037 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Rat Receptor Tyrosine-Protein Kinase Erb...
-

Recombinant Human CD79B/B29 (C-6His) #abs04023
-

Recombinant Human CD19 (C-Fc) #abs04018
-

Recombinant Human Complement Component C1q Receptor/...
-

Recombinant Human CD83/HB15 (C-6His) #abs04010
-

Recombinant Human Urokinase Plasminogen Activator Su...
