
Recombinant Human Complement Component C1q Receptor/C1QR1/CD93 (C-6His) #abs04012
Please note that the mentioned price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. It is important to mention that the content generated is to be based on the original text and rearranged in a highly similar manner. However, it is...
Description
Catalog-specification | Delivery time | USD price |
abs04012-10ug | 1-2 Weeks | 161 |
abs04012-50ug | 1-2 Weeks | 482 |
abs04012-500ug | 1-2 Weeks | 2353 |
abs04012-1mg | 1-2 Weeks | 3201 |
Please note that the mentioned price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. It is important to mention that the content generated is to be based on the original text and rearranged in a highly similar manner. However, it is advised not to engage in a dialogue based on ChapGPT-generated content, but to employ a completely different approach in delivering the speech using a language model.
Overview | |
Description | Our Mammalian expression system is capable of producing Recombinant Human C1q receptor 1. The target gene, which encodes Ala24-Lys580, is expressed with a 6His tag at the C-terminus. |
Other names | C1q receptor, also known as complement component C1q receptor, C1q/MBL/SPA receptor, C1qR (p), C1qRp, CDw93, complement component 1 q subcomponent receptor 1, matrix-remodeling-associated protein 4CD93, C1QR1, or MXRA4. This receptor plays a crucial role in the immune system by recognizing and binding to complement component C1q. It is involved in various biological processes, including complement activation, phagocytosis, immune response regulation, and tissue remodeling. The receptor has multiple names due to its different identifications in various research studies and its association with different biological functions. Despite the varied nomenclatures, all these terms refer to the same protein and are used interchangeably in scientific literature. |
Source | Human Cells |
Format | The solution used for lyophilization was prepared by filtering it through a 0.2 μm filter and contained 20mM PB, 150mM NaCl, and had a pH value of 7.2. Can you please suggest any modifications required in the generated content? |
Properties | |
aa_sequence | LAAEKQLRLVQRAHVQHEASKEVKTALNNGGQNCNQHAEASSKEGLSACVKCYTGTVCCGVVVTEAD CARAESLASLRRVEPLSKFWIGLERKKGLCSGFSWVGGGEDHYVNWHKELRNSRCSKIALFILDRQL LTSCSPLPKWSEGPGSNIEGFVCKMSFKGMCPNLALGGAGQVSHTTFPQTTSSSLEAVPFASSANV ICGEGDKDETQSHYFLCKEKAPDVFDWSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPI FRLIDDVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAC VNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEVLAGEDGTQCQ DVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGS TVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQ EPAGGDSSVATQNNDGTDGQKVDHHHHHH. |
Concentration | SDS-PAGE,95%。,,。, ChhatGPT ,。 |
Endotoxin_level | According to the LAL test, the presence of endotoxin is determined to be below 0.1 ng/μg (1 IEU/μg). |
Reconstitution | Before opening, centrifuge the tubes. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute to a concentration lower than 100 μg/ml. Dissolve the lyophilized protein using ddH2O. To avoid freeze-thaw cycles, divide the reconstituted solution into smaller portions. Please note that the generated content differs from the original text and is based on the text information provided. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | C1q R1 is also known as CD93, collectin receptor, and AA4 antigen, belongs to the Group XIV C-Type lectin family which play a role not only in cell–cell adhesion processes but also in host defence. All of them contain a C-type lectin domain, a series of epidermal growth factor like domains (EGF), a highly glycosylated mucin-like domain, a unique transmembrane domain and a short cytoplasmic tail. C1q R1 has also been identified as a hematopoietic stem cell marker. |
Accession | Q9NPY3 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human complement component c1q receptor/c1qr1/cd93 (c-6his) #abs04012, China recombinant human complement component c1q receptor/c1qr1/cd93 (c-6his) #abs04012 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human Urokinase Plasminogen Activator Su...
-

Recombinant Human CD47/IAP/OA3 (C-6His) #abs04007
-

Recombinant Human CD46/MCP (C-6His) #abs04006
-

Recombinant Human OX-2/MOX1/CD200 (C-6His) #abs04003
-

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His) #ab...
-

Recombinant Human CD14 (C-6His) #abs04000
