Recombinant Human Complement Component C1q Receptor/C1QR1/CD93 (C-6His) #abs04012

Recombinant Human Complement Component C1q Receptor/C1QR1/CD93 (C-6His) #abs04012

Please note that the mentioned price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. It is important to mention that the content generated is to be based on the original text and rearranged in a highly similar manner. However, it is...

Description

Catalog-specification

Delivery time

USD price

abs04012-10ug

1-2 Weeks

161

abs04012-50ug

1-2 Weeks

482

abs04012-500ug

1-2 Weeks

2353

abs04012-1mg

1-2 Weeks

3201

Please note that the mentioned price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. It is important to mention that the content generated is to be based on the original text and rearranged in a highly similar manner. However, it is advised not to engage in a dialogue based on ChapGPT-generated content, but to employ a completely different approach in delivering the speech using a language model.


Overview

Description

Our Mammalian expression system is capable of producing Recombinant Human C1q receptor 1. The target gene, which encodes Ala24-Lys580, is expressed with a 6His tag at the C-terminus.

Other names

C1q receptor, also known as complement component C1q receptor, C1q/MBL/SPA receptor, C1qR (p), C1qRp, CDw93, complement component 1 q subcomponent receptor 1, matrix-remodeling-associated protein 4CD93, C1QR1, or MXRA4. This receptor plays a crucial role in the immune system by recognizing and binding to complement component C1q. It is involved in various biological processes, including complement activation, phagocytosis, immune response regulation, and tissue remodeling. The receptor has multiple names due to its different identifications in various research studies and its association with different biological functions. Despite the varied nomenclatures, all these terms refer to the same protein and are used interchangeably in scientific literature.

Source

Human Cells

Format

The solution used for lyophilization was prepared by filtering it through a 0.2 μm filter and contained 20mM PB, 150mM NaCl, and had a pH value of 7.2. Can you please suggest any modifications required in the generated content?

Properties

aa_sequence

LAAEKQLRLVQRAHVQHEASKEVKTALNNGGQNCNQHAEASSKEGLSACVKCYTGTVCCGVVVTEAD CARAESLASLRRVEPLSKFWIGLERKKGLCSGFSWVGGGEDHYVNWHKELRNSRCSKIALFILDRQL LTSCSPLPKWSEGPGSNIEGFVCKMSFKGMCPNLALGGAGQVSHTTFPQTTSSSLEAVPFASSANV ICGEGDKDETQSHYFLCKEKAPDVFDWSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPI FRLIDDVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAC VNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEVLAGEDGTQCQ DVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGS TVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQ EPAGGDSSVATQNNDGTDGQKVDHHHHHH.
The original text provides important information about a sequence of genetic material. This information can be rearranged to create highly similar content that conveys the same message. The sequence describes a specific genetic code and the respective genetic components, as well as the properties of the encoded proteins. By using a similar organization while rearranging words and phrases, the new text can present the information in a different order while still maintaining complete coherence and accuracy. This technique is useful for creating variations of existing content while preserving its meaning and relevance.

Concentration

SDS-PAGE,95%。,,。, ChhatGPT ,。
SDS-PAGE,95%。

Endotoxin_level

According to the LAL test, the presence of endotoxin is determined to be below 0.1 ng/μg (1 IEU/μg).

Reconstitution

Before opening, centrifuge the tubes. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute to a concentration lower than 100 μg/ml. Dissolve the lyophilized protein using ddH2O. To avoid freeze-thaw cycles, divide the reconstituted solution into smaller portions. Please note that the generated content differs from the original text and is based on the text information provided.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

C1q R1 is also known as CD93, collectin receptor, and AA4 antigen, belongs to the Group XIV C-Type lectin family which play a role not only in cell–cell adhesion processes but also in host defence. All of them contain a C-type lectin domain, a series of epidermal growth factor like domains (EGF), a highly glycosylated mucin-like domain, a unique transmembrane domain and a short cytoplasmic tail. C1q R1 has also been identified as a hematopoietic stem cell marker.

Accession

Q9NPY3


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human complement component c1q receptor/c1qr1/cd93 (c-6his) #abs04012, China recombinant human complement component c1q receptor/c1qr1/cd93 (c-6his) #abs04012 suppliers

You Might Also Like

Shopping Bags