Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His) #abs04002

abs04002-10ug

1-2 Weeks

123

abs04002-50ug

1-2 Weeks

337

abs04002-500ug

1-2 Weeks

2353

abs04002-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system produces Recombinant Human KIR2DL4, which includes the target gene Trp22-His242 with a 6His tag located at the C-terminus. This ensures that our product is highly specific and easy to identify. We take great care in our production process to ensure consistency and quality in every batch.

Other names

2DL4 Killer Cell Immunoglobulin-Like Receptor, CD158 Antigen-Like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, KIR-103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d, KIR2DL4, CD158D, KIR103AS are all different names for the same protein.
This protein is known as Killer Cell Immunoglobulin-Like Receptor 2DL4, which is a member of the CD158 antigen-like family. It is also referred to as G9P, Killer Cell Inhibitory Receptor 103AS, KIR-103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d, KIR2DL4, CD158D, KIR103AS.
The Killer Cell Immunoglobulin-Like Receptor 2DL4 (KIR2DL4) is an inhibitory receptor found on natural killer (NK) cells and has a significant role in immune response regulation. It is involved in recognizing major histocompatibility complex class I (MHC-I) molecules on target cells. By binding to MHC-I molecules, KIR2DL4 helps to modulate the activity of NK cells, preventing the killing of healthy cells.
The CD158 antigen-like family, to which KIR2DL4 belongs, comprises a group of receptors that have similar structures and functions. These receptors are expressed on various immune cells, including NK cells and some T cells. They play a crucial role in immune surveillance and defense against infected or transformed cells.
The alternative names, such as G9P, CD158d, CD158D, KIR-103AS, MHC Class I NK Cell Receptor KIR103AS, are used to describe specific characteristics or variants of the KIR2DL4 protein. These names may refer to specific isoforms, gene polymorphisms, or specific functional domains of the receptor. They help to provide more detailed information about the specific features or variants of KIR2DL4 being referred to in scientific literature or clinical research.
In summary, Killer Cell Immunoglobulin-Like Receptor 2DL4, also known as CD158 Antigen-Like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, KIR-103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d, KIR2DL4, CD158D, KIR103AS, is an important inhibitory receptor expressed on NK cells. It belongs to the CD158 antigen-like family and plays a significant role in immune response regulation and the recognition of MHC-I molecules on target cells. Various alternative names are used to describe specific characteristics or variants of this protein.

Source

Human Cells

Format

The solution was first filtered through a 0.2μm filter and then lyophilized to obtain a dry powder. The original solution was prepared using 20mM PB and 150mM NaCl, with pH set to 7.4.

Properties

aa_sequence

APHLRSELYVPENRPIFSWSSTQLIKYVTTRGHGERYSFCLIVNNRFKHTGCCRFQVTASLSVPD GFIHSHEVFTGGETHVTRGPGKLYVPKDSATWPAQSGWPSASYPGNSAPLNSLFNYFHWQGRTV ISGFNLPTVCSVFPSSGTVGTENRHKDLPIARYLYKEVLLGNAHHFPGGKLTYRGQGAGPDYVC RHFDSNFPLWAAIRPTSPEANHDGVTIPYTGGVTAQHPLLSSVRWNENSHPQPARQHLSPGVT.Sup
GTVSVASPFTKELYGQPGNADGDWFPNHFCCQskipIsnHSHTQNLLIVGRTTAGTSPHVWNSLSE PIGQVWFSNKGGTLRAYHSDTYDPNPHAHGETVLGNSRFPLTQDIFFSFKPWSTGSNVLPVES PYTPGHNPLVAGWGTYLQEVNHERYLRIATPSVSSTPQKGHGFLEGGATNHIWLPQTFEYRCS STHHVDHLVPSSRAHRKGLGGCSDDGASKEFYSNFWNNTNPFYFSTSFLKS.P

Concentration

Our analysis using SDS-PAGE revealed a protein purity greater than 95%. This indicates that the sample is highly pure and suitable for further experimentation.

Endotoxin_level

The LAL test has determined that the concentration of endotoxin in the sample is less than 0.1 ng/μg (1 IEU/μg). This indicates that the sample is relatively free from endotoxin contamination.

Reconstitution

To ensure the integrity of your samples, it is essential to follow some crucial steps when handling your protein. Firstly, always remember to centrifuge your tubes before opening to prevent sample contamination. It is also vital to avoid mixing by vortex or pipetting, as this can disrupt your protein structure and lead to inaccuracies. When it comes to reconstitution, it is not advisable to dissolve the lyophilized protein in concentrations lower than 100 μg/ml. Instead, use ddH2O and aliquot your reconstituted solution to minimize the freeze-thaw cycle. By following these guidelines, you should be able to maintain the quality of your protein samples for accurate results.

Stability & Storage

The recommended storage conditions for lyophilized protein are at temperatures below -20°C. However, it is worth noting that the protein remains stable at room temperature for a period of 3 weeks. On the other hand, once the protein is reconstituted and in solution form, it is advised to store it at temperatures between 4-7°C. Under these conditions, the reconstituted protein solution can be safely stored for a span of 2-7 days. If there is a need to store aliquots of the reconstituted samples for a longer duration, it is recommended to keep them at temperatures below -20°C as they will remain stable for a period of 3 months.

Target

Background

Killer cell immunoglobulin-like receptor 2DL4(KIR2DL4) is a Single-pass type I membrane protein and contains 2 Ig-like C2-type (immunoglobulin-like) domains.It belongs to the immunoglobulin superfamily. KIR2DL4 is expressed in all NK cells and some T cells. KIR2DL4 activates the cytotoxicity of NK cells, despite the presence of an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic tail. The ITIM was not necessary for activation of lysis by KIR2DL4. The activation signal of KIR2DL4 was sensitive to inhibition by another ITIM-containing receptor. The activation-deficient mutant of KIR2DL4 inhibited the signal delivered by the activating receptor CD16.

Accession

Q99706