
Recombinant Human CD46/MCP (C-6His) #abs04006
Please note that the mentioned price is only provided as a reference. For accurate and detailed pricing information, kindly get in touch with our seller, Vecent. Feel free to contact Vecent for further clarification on pricing. This product is for research use only, not for use in diagnostic...
Description
Catalog-specification | Delivery time | USD price |
abs04006-10ug | 1-2 Weeks | 161 |
abs04006-50ug | 1-2 Weeks | 482 |
abs04006-500ug | 1-2 Weeks | 2353 |
abs04006-1mg | 1-2 Weeks | 3201 |
Please note that the mentioned price is only provided as a reference. For accurate and detailed pricing information, kindly get in touch with our seller, Vecent. Feel free to contact Vecent for further clarification on pricing.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human CD46, which is expressed with a 6His tag at the C-terminus. The target gene encoding Cys35-Asp328 is utilized in this production process. Our aim is to generate a highly similar content but in a dissimilar way, keeping in mind the original text information. |
Other names | TLX, Trophoblast Leukocyte Common Antigen, CD46, MCP, and MIC10 are all variously known as Membrane Cofactor Protein. This important molecule is involved in regulating the immune system and protecting the body from infection. It is found on the surface of many different types of cells, including white blood cells and trophoblasts (cells that form the placenta during pregnancy). By binding to complement proteins and other molecules, MCP helps to prevent these substances from damaging healthy cells and tissues. In addition to its role in immunity, MCP also plays a role in cell signaling, migration, and survival, making it an important target for future therapeutic interventions. Overall, understanding the function of MCP and its various aliases is crucial for understanding the complex workings of the immune system and developing new treatments for a variety of diseases. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized to produce a dry powder. The original solution consisted of 20mM PB, 150mM NaCl, and had a pH of 7.4. |
Properties | |
aa_sequence | PKTSGPLPKKMEAECRHHHDGPDFSLEGYIGCGVENGQAEEHFAGFYKKGTRACVSDPTYLDSSEW PPICTKTGKVSIKLGGKLCEEPKAFLIGYYCDYCNNLIDHHAWCRTMVDGKISAVEDKHYPLEYF FPLNCGWRFVEEFNDPTAWFTKDFYETSGRCIDDLGLCVPYIKCEISLDVGPACESCTTASGKAS SPNHVSPNSPEEGKRIYATKKVSYRGEDWCYTELNNGCCMCGSGPLPEENFIHSSGTYEGRDHAD. |
Concentration | The SDS-PAGE reduction method determined that the protein purity was over 95%. Can you create a similar statement using different wording but based on the same information from the original text? |
Endotoxin_level | The LAL test revealed that the level of endotoxin present is less than 0.1 ng/μg (equivalent to 1 IEU/μg). A similar statement can be made by rephrasing the original text to convey the same information in a different way. |
Reconstitution | To ensure accurate results, it is important to follow the proper procedure when handling centrifuge tubes. Before opening the tubes, always make sure to centrifuge them first. Avoid using vortex or pipetting to mix the contents, as this can lead to inaccurate measurements. It is not recommended to dilute the concentration of the lyophilized protein to less than 100 μg/ml. Instead, dissolve the lyophilized protein in ddH2O. After reconstitution, it is advisable to aliquot the solution into smaller portions to minimize the occurrence of freeze-thaw cycles. |
Stability & Storage | The recommended storage conditions for lyophilized protein include storing it below -20°C. However, it is worth mentioning that it can remain stable at room temperature for a period of three weeks. On the other hand, if the protein is reconstituted and turned into a solution, it is advisable to store it at a temperature range of 4-7°C for a duration of 2-7 days. In case you prefer to aliquot the reconstituted samples, they can be safely stored at a temperature below -20°C for up to three months. |
Target | |
Background | CD46 is a type I membrane protein containing four Sushi domains. CD46 is expressed by all cells except erythrocytes. CD46 has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. It may be involved in the fusion of the spermatozoa with the oocyte during fertilization. CD46 also acts as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity. A number of viral and bacterial pathogens exploit this property and directly induce an immunosuppressive phenotype in T-cells by binding to CD46. CD46 acts as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. |
Accession | P15529 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human cd46/mcp (c-6his) #abs04006, China recombinant human cd46/mcp (c-6his) #abs04006 suppliers
Send Inquiry
You Might Also Like






