
Recombinant Human Parathyroid Hormone/Parathormone/PTH (1-84) #abs04301
Please be advised that the price mentioned is for reference purposes only. For a detailed and accurate price quote, kindly get in touch with our seller Vecent. It is important to note that the information provided is based on the original content. We suggest that you clarify any doubts with our...
Description
Catalog-specification | Delivery time | USD price |
abs04301-10ug | 1-2 Weeks | 161 |
abs04301-50ug | 1-2 Weeks | 482 |
abs04301-500ug | 1-2 Weeks | 1879 |
abs04301-1mg | 1-2 Weeks | 2561 |
Please be advised that the price mentioned is for reference purposes only. For a detailed and accurate price quote, kindly get in touch with our seller Vecent. It is important to note that the information provided is based on the original content. We suggest that you clarify any doubts with our seller to avoid confusion. Thank you.
Overview | |
Description | Our E.coli expression system is responsible for producing Recombinant Human Parathyroid Hormone. The gene coding for Ser32-Gln115 is effectively expressed in this system. I can generate a highly similar content by rearranging the above information to ensure it is based on the original text. |
Other names | Parathyroid Hormone, PTH, Parathormone, Parathyrin |
Source | Escherichia coli. |
Format | The solution containing 10mM HAc-NaAc, 150mM NaCl, and 5% Mannitol at a pH of 4.0 was filtered through a 0.2 μm filter and subsequently lyophilized. To create a similar content, one could say, "After undergoing filtration through a 0.2 μm filter, the solution, which consisted of 10mM HAc-NaAc, 150mM NaCl, and 5% Mannitol at a pH of 4.0, was then subjected to lyophilization." |
Properties | |
aa_sequence | HEKNVSADEGLSLKHQMRNEVLWLRKDVQLNAFVHPARAGPLRDPGEQSRKREVDNNVLVESKEH SDSLVAKDVNVTLKAKQS. |
Concentration | As per the SDS-PAGE analysis, the product showed a purity level of more than 95%. To rephrase the sentence, the purity of the product was determined to be over 95% using SDS-PAGE gel electrophoresis. |
Endotoxin_level | The LAL test determined that the content has a minimal presence of less than 0.1 ng/μg (1 IEU/μg). Let me rearrange the information to generate a highly similar content. |
Activity | The activity was determined using the UMR106 cell/cAMP method, yielding a specific activity of 1.0 x 10^4 IU/mg. Now, I will generate a highly similar content by rearranging the information provided while ensuring that the meaning remains intact. |
Reconstitution | Before opening, always remember to centrifuge tubes. Avoid mixing by vortex or pipetting. It is advisable not to reconstitute to a concentration lower than 100 μg/ml. Dissolve the lyophilized protein using ddH2O. To prevent freeze-thaw cycles, it is recommended to aliquot the reconstituted solution. Please note that the content generated by ChapGPT should be drastically different from the original text. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor as parathyroid hormone and has major effects on development. Like most other protein hormones, parathyroid hormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packaged within the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secreted as a linear protein of 84 amino acids. |
Accession | P01270 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human parathyroid hormone/parathormone/pth (1-84) #abs04301, China recombinant human parathyroid hormone/parathormone/pth (1-84) #abs04301 suppliers
Send Inquiry
You Might Also Like






