Recombinant Human Interferon Lambda-2/IL-28A(C-6His) #abs04130

Recombinant Human Interferon Lambda-2/IL-28A(C-6His) #abs04130

Please note that the price mentioned above is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. We recommend contacting Vecent for accurate and up-to-date pricing details. This product is for research use only, not for use in diagnostic...

Description

Catalog-specification

Delivery time

USD price

abs04130-10ug

1-2 Weeks

161

abs04130-50ug

1-2 Weeks

482

abs04130-500ug

1-2 Weeks

1925

abs04130-1mg

1-2 Weeks

2619

Please note that the price mentioned above is for your reference only. For detailed pricing information, kindly get in touch with our seller, Vecent. We recommend contacting Vecent for accurate and up-to-date pricing details.


Overview

Description

Our Mammalian expression system is responsible for producing Recombinant Human Interferon Lambda-2. This system expresses the target gene, which encodes Val26-Val200, with a 6His tag located at the C-terminus.

Other names

IFN-lambda-2, also known as Interferon lambda-2, Zcyto20 cytokine, or Interleukin-28A, plays a crucial role in innate immunity. Often referred to as IL-28A or IFNL2, this cytokine, coded by the IL28A gene, exhibits high similarity to ZCYTO20. The function of IFN-lambda-2 is to induce antiviral activity in response to viral infections, making it a vital component of the immune response against pathogens. By rearranging the provided information, we can gather that IFN-lambda-2, with its alternate names IL-28A, IL28A, IFNL2, and ZCYTO20, is a significant cytokine involved in immune defense mechanisms against viral infections.

Source

Human Cells

Format

The solution of PBS at pH 7.4 was filtered through a 0.2 μm membrane and then lyophilized. I would like to generate highly similar content by rearranging the original text information. However, it is important to note that this conversation should not follow the style of generating content using ChapGPT. Instead, I will provide a completely different approach to speak using the language model to generate text.

Properties

aa_sequence

HHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVHHHHHH, VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQ VRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRL.

Concentration

SDS-PAGE,95%。,。

Endotoxin_level

The LAL test confirmed that the level of contamination is extremely low, measuring at less than 0.1 ng/μg (1 IEU/μg).

Reconstitution

To ensure accurate results, it is advised to centrifuge tubes prior to opening. Avoid mixing by vortexing or pipetting. It is not advisable to dilute the lyophilized protein to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To prevent degradation, it is recommended to divide the reconstituted solution into smaller portions and avoid repeated freeze-thaw cycles.

Stability & Storage

For optimum storage of lyophilized protein, it is recommended to keep it at a temperature below -20°C. However, it can be stored at room temperature for a period of 3 weeks. In order to extend its shelf life, reconstituted protein solution should be stored at a temperature of 4-7°C for a maximum of 2-7 days. For long-term storage, it is advisable to prepare aliquots of reconstituted samples and store them at a temperature of less than -20°C for up to 3 months. By following these guidelines, the stability of the protein can be ensured and its effectiveness maintained.

Target

Background

IL-28A, IL-28B, and IL-29 are type III interferons that belong to the IL-10 family and are distantly related to the type I IFN family cytokines. IL-28A is a mature protein of approximately 22-25 kDa and has significant sequence similarities with its mouse and rat counterparts, exhibiting cross-species activity. It shares 96% sequence identity with IL-28B and 70% sequence identity with IL-29 in humans.
One of the functional roles of IL-28A is its ability to promote the Th1 polarization of dendritic cells in the airway, while inhibiting inflammation mediated by Th2 and Th17 cells. Additionally, IL-28A possesses anti-tumor activity, partly by enhancing IL-12-dependent anti-tumor cytotoxic T lymphocyte (CTL) responses in vivo. This suggests its potential as a therapeutic agent against tumors. However, in invasive bladder cancer, IL-28A is up-regulated and promotes tumor cell migration, indicating a dual role in cancer biology.

Accession

Q8IZJ0


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human interferon lambda-2/il-28a(c-6his) #abs04130, China recombinant human interferon lambda-2/il-28a(c-6his) #abs04130 suppliers

You Might Also Like

Shopping Bags