
Recombinant Mouse Interferon α-2 #abs04129
Please note that the price mentioned above is only for your reference. For more detailed pricing information, we recommend getting in touch with our seller Vecent. We strive to provide the most accurate information possible and are happy to help answer any questions you may have. So please feel...
Description
Catalog-specification | Delivery time | USD price |
abs04129-10ug | 1-2 Weeks | 46 |
abs04129-50ug | 1-2 Weeks | 138 |
abs04129-500ug | 1-2 Weeks | 917 |
abs04129-1mg | 1-2 Weeks | 1382 |
Please note that the price mentioned above is only for your reference. For more detailed pricing information, we recommend getting in touch with our seller Vecent. We strive to provide the most accurate information possible and are happy to help answer any questions you may have. So please feel free to contact us at any time for more information. Thank you for choosing our services!
Overview | |
Description | Our E.coli expression system is utilized to produce Recombinant Mouse Interferon alpha-2. The expressed protein is coded by the target gene that encodes the amino acids Cys24-Glu190. We ensure that the result is highly similar to the original content by rearranging it while still preserving the essential information. |
Other names | IFNA2, Interferon Alpha-A, IFN-Alpha-2, LeIF A, Interferon Alpha-2 - these are different names referring to the same substance. They all denote a type of interferon known as Interferon Alpha-2. It is a protein produced by the human body as part of the immune response to viral infections. Interferon Alpha-2 has antiviral properties and is used medically to treat certain diseases such as hepatitis B and C, as well as some forms of cancer. Its therapeutic effects are attributed to its ability to inhibit viral replication and enhance the body's immune response. The various names used to describe this substance simply reflect different conventions or nomenclature used in different contexts or by different researchers. However, regardless of the name used, the essential properties and medical applications of Interferon Alpha-2 remain the same. |
Source | Escherichia coli. |
Format | The solution containing 20mM PB, 100mM NaCl, and pH 7.5 was passed through a 0.2 μm filter and then lyophilized. |
Properties | |
aa_sequence | QNPKTDPHKFDMDNDLRQDFAQDFLCPQQTFGNPDVLQAEEQKLARLNADVYQDKGRYKILLTTTTVT TTJAAYNNSPKKFLLQDMLHWEMHQDEATPTLVRKAESDACPLFPLVQLAECGKRNVLELFSHIKK RRSQDKEAVNLLGLLKDLPAIPLRFVHNKVCLQMLT. |
Concentration | As determined by SDS-PAGE reduction, the protein sample exhibited a greater than 95% similarity. To create comparable content, one might express this information in a slightly different way: According to analysis by SDS-PAGE reduction, the protein sample demonstrated a similarity level exceeding 95%. |
Endotoxin_level | According to the LAL test, the level of endotoxin in the sample is less than 0.1 ng/μg (1 IEU/μg). |
Reconstitution | To ensure accurate results, it is important to always centrifuge tubes before opening and refrain from mixing the contents by vortex or pipetting. When reconstituting lyophilized protein, it is recommended to use a concentration of at least 100 μg/ml and dissolve it in ddH2O. It is also recommended to aliquot the solution to minimize the number of freeze-thaw cycles. Following these guidelines can help maintain the integrity and effectiveness of the protein. |
Stability & Storage | For optimal storage, it is recommended that lyophilized protein be kept at a temperature below -20°C. However, it can remain stable at room temperature for up to 3 weeks. Once reconstituted, the protein solution should be kept refrigerated at 4-7°C for 2-7 days. To further extend the shelf life of the sample, it is advisable to aliquot and store at a temperature below -20°C for up to 3 months. |
Target | |
Background | There exist 23 distinct variants of Interferon-α, each characterized by molecular masses ranging from 19-26 kD. These variants consist of proteins with lengths of either 156-166 or 172 amino acids. An intriguing feature is the presence of a conserved sequence region shared by all IFN-α subtypes, specifically between amino acid positions 115-151. However, the amino-terminal ends of these proteins exhibit considerable variability. Remarkably, the dissimilarities among many IFN-α subtypes are confined to only one or two positions in their amino acid sequences. Besides these variations, naturally occurring IFN-α variants also include proteins that have been truncated by 10 amino acids at the carboxyl-terminal end. |
Accession | P01573 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse interferon α-2 #abs04129, China recombinant mouse interferon α-2 #abs04129 suppliers
Send Inquiry
You Might Also Like






