Recombinant Human Interferon α2B Variant (Arg46)/IFN-α2B #abs04122

abs04122-10ug

1-2 Weeks

77

abs04122-50ug

1-2 Weeks

214

abs04122-500ug

1-2 Weeks

566

abs04122-1mg

1-2 Weeks

771

Description

Our E.coli expression system is utilized for the production of Recombinant Human Interferon alpha-2b, wherein the target gene encoding Cys24-Glu188 is expressed.

Other names

Interferon Alpha-2, also known as IFN-Alpha-2 or Interferon Alpha-A, is commonly referred to as LeIF A or IFNA2.

Source

Escherichia coli.

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. The resulting product was based on a composition of 20mM PB, 150mM NaCl, and had a pH of 7.2.

Properties

aa_sequence

LQFNLKLRHLIAQPTRSLMSRTSFLSKCQDGREFHGQNFEFQAKAMIEVPHLETIMQQFQISDK NSTWADKYDTFLELQTYELYQLNLDECVIGQTVTEPLMKEASLRVYFKRILTLYKESPWKAEVE RRIAAESITFSLMRSLSQNLQSEKLD.

Concentration

The SDS-PAGE reduction method showed that the similarity level was over 95%. Can you create a text that conveys the same information but with different wording?

Endotoxin_level

As determined by the LAL test, the concentration of less than 0.1 ng/μg (1 IEU/μg) is found. Let me generate a highly similar content by rearranging the above information.

Activity

The viral resistance assay was conducted using VSV-WISH cells to measure the effectiveness. The specific activity obtained was found to be greater than 1.0 x 10^8 IU/mg. To maintain content similarity, rearrange the provided information as follows: The effectiveness of the substance was assessed by conducting a viral resistance assay using VSV-WISH cells. The obtained results demonstrated a specific activity higher than 1.0 x 10^8 IU/mg.

Reconstitution

Always ensure proper centrifugation of tubes before opening and avoid mixing by vortex or pipette. It is strongly advised that the protein is not reconstituted to a concentration less than 100 μg/ml. To dissolve the lyophilized protein, use ddH2O and please be sure to aliquot the reconstituted solution to prevent multiple freeze-thaw cycles. It is recommended to produce content that is similar to the original text by rearranging the instructions presented above. However, we actually suggest using a language model to generate a distinct and unique text that showcases creative language use.

Stability & Storage

The storage requirements for lyophilized protein should be carefully considered. It is recommended to store the protein at a temperature below -20°C to maintain its stability. However, if needed, the protein can be kept at room temperature for up to 3 weeks without significant degradation.
On the other hand, once the lyophilized protein is reconstituted into a solution, it has different storage guidelines. The reconstituted protein solution should be stored at a temperature of 4-7°C. Under these conditions, the protein remains stable for a period ranging from 2 to 7 days.
To ensure long-term storage of the reconstituted protein, it is advisable to aliquot the solution into smaller portions and store them at a temperature below -20°C. By doing so, the stability of the protein can be maintained for up to 3 months.
In summary, when handling lyophilized protein, it is crucial to follow the recommended storage conditions. This entails storing the lyophilized form at a temperature below -20°C and refraining from exposing it to room temperature for more than 3 weeks. Moreover, after reconstitution, the protein solution should be kept at 4-7°C for a few days or aliquoted and stored below -20°C for extended periods. Adhering to these guidelines will help ensure the integrity and longevity of the protein samples.

Target

Background

At least 23 different variants of IFN-α are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-α subtypes differ in their sequences by only one or two positions. Naturally occurring variants also include proteins that are truncated by 10 amino acids at the carboxyl-terminal end.

Accession

P01563