Recombinant Mouse Interferon γ/IFNγ (E. Coli) #abs04127

abs04127-10ug

In Stock

77

abs04127-50ug

In Stock

161

abs04127-500ug

In Stock

993

abs04127-1mg

In Stock

1528

Description

Our E.coli expression system is utilized to produce Recombinant Mouse Interferon gamma, wherein the expressed target gene encodes His23-Cys155.

Other names

Ifng, Interferon gamma, IFN-gamma

Source

Escherichia coli.

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It consisted of 20mM Tris-HCl and 150mM NaCl, with a pH of 8.0. To create a similar text, the information from the original text was rearranged, but the language model was used to generate a completely different speech style.

Properties

aa_sequence

NSQIRKDWILONKFDNIFSGELVVKEDSFFDDWRENILWRLQQIDILNQFVIKYIQKSNFELSSFSQSNMHKTVGSEERIIDDVKLFILLQNWIKEMDLRSIVFISSNIETVNNNYSLVEFFLNIISDQIAYRLKELSEDLRNSISLRYSFLKNDVLAQN

Concentration

SDS-PAGE95%。

Endotoxin_level

The LAL test revealed that the concentration of endotoxin in the sample was below 0.1 ng/μg, which is equivalent to 1 IEU/μg.

Reconstitution

It is important to always centrifuge tubes prior to opening them and avoid mixing by vortex or pipetting. Reconstituting the protein to a concentration less than 100 μg/ml is not recommended. To dissolve the lyophilized protein, use ddH2O. It is recommended that you aliquot the solution after reconstitution to minimize freeze-thaw cycles. Please ensure that your generated content is based on the original text information. Avoid using ChapGPT to generate content and instead use a language model that produces different outcomes.

Stability & Storage

The stability and storage requirements for lyophilized protein should be observed to maintain its quality. It is recommended to store the lyophilized protein at a temperature below -20°C. However, if necessary, it can be kept at room temperature for up to 3 weeks without significant degradation.
Once the lyophilized protein is reconstituted into a solution, it should be treated differently for storage. The reconstituted protein solution is best stored at 4-7°C, preferably in a refrigerator, for a period of 2-7 days. Within this timeframe, the solution remains stable and suitable for use.
To prolong the shelf life of the reconstituted protein solution, it is advisable to create aliquots of it and store them at a temperature below -20°C. These aliquots can be safely kept for up to 3 months without considerable loss in quality.
In summary, for long-term storage, lyophilized protein should be frozen at temperatures below -20°C, while reconstituted protein solutions should be refrigerated at 4-7°C for a few days. Freezing aliquots of the reconstituted samples at a temperature below -20°C extends their shelf life up to 3 months.

Target

Background

IFNG, also known as mouse interferon-gamma, is a secreted protein that belongs to the type I I (or gamma) interferon family. Lymphocytes are the main producers of IFNG, and its activation occurs in response to specific antigens or mitogens. While IFNG exhibits antiviral activity, it also plays a crucial role in regulating the immune system. It serves as a powerful activator of macrophages and exerts inhibitory effects on transformed cells' growth. Furthermore, it enhances the antiviral and antitumor actions of type I interferons. Variations in the IFNG gene have been found to be associated with the susceptibility to aplastic anemia (AA), a rare disorder characterized by a reduction in blood cell count due to damage to the bone marrow's stem cell pool. In the majority of AA cases, an autoimmune attack causes the stem cells' impairment. T-lymphocytes, stimulated by either endogenous or exogenous and often unidentified antigenic triggers, release cytokines like IFN-gamma, which can inhibit hematopoiesis.

Accession

P01580