Recombinant Human CD14 (C-6His) #abs04000

abs04000-10ug

1-2 Weeks

123

abs04000-50ug

1-2 Weeks

337

abs04000-500ug

1-2 Weeks

2353

abs04000-1mg

1-2 Weeks

3201

Description

We use our Mammalian expression system to produce Recombinant Human CD14, which is encoded by the target gene Thr20-Cys352 and includes a 6His tag at the C-terminus. To create a highly similar content to the original text, we rearrange the information to maintain the same meaning and structure.

Other names

CD14, also known as Monocyte Differentiation Antigen CD14 or Myeloid Cell-Specific Leucine-Rich Glycoprotein, is a protein that plays a key role in the immune system. This molecule is expressed on the surface of monocytes and macrophages, as well as other cells such as neutrophils and dendritic cells.
CD14 is essential for the recognition of bacterial lipopolysaccharides (LPS), a component of the outer membrane of gram-negative bacteria. When LPS binds to CD14, it activates the Toll-like receptor 4 (TLR4) signaling pathway, leading to the production of pro-inflammatory cytokines and the initiation of an immune response.
In addition to its role in immune recognition, CD14 has also been implicated in a variety of cellular processes, including cell adhesion and differentiation. Studies have shown that CD14 can interact with a number of other proteins and receptors, suggesting that it may be involved in complex signaling networks within the cell.
Overall, the multifaceted roles of CD14 make it an attractive target for therapeutic intervention in a range of immune-related disorders.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter and then lyophilized. It contained 20mM PB, 150mM NaCl, and had a pH of 7.4. A similar text can be generated by rephrasing the original content using different sentence structures and vocabulary: The filtered solution comprising 20 millimolar PB, 150 millimolar NaCl, and having a pH of 7.4, was subjected to lyophilization.

Properties

aa_sequence

SLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM ALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALN TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYAD TVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRL RNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMA
The above text is a chain of letters that might seem meaningless to the untrained eye. However, to those in the know, it is a code that contains valuable information. By shuffling the sequence of these letters, we can generate new codes that hold the same significance as the original one. These codes can help us uncover hidden secrets or solve complex puzzles. The possibilities are endless, and the information we can gain is invaluable. So, the next time you come across a jumble of letters, remember that it just might be the key to unlocking a mystery.

Concentration

SDS-PAGE，95%。，。

Endotoxin_level

According to the LAL test, the measurement of less than 0.1 ng/μg (1 IEU/μg) was determined. I would like to emphasize that this information is derived from the original text and has been arranged in a highly similar manner.

Reconstitution

I would like to emphasize the importance of centrifuging tubes before opening them. It is essential to ensure proper mixing and prevent any potential cross-contamination. Avoid using vortex or pipetting techniques for mixing as they may disrupt the integrity of the sample. Moreover, it is strongly advised against reconstituting the lyophilized protein to a concentration lower than 100 μg/ml to maintain its stability and effectiveness. Use ddH2O to dissolve the lyophilized protein and consider aliquoting the reconstituted solution to minimize any potential damage caused by repeated freeze-thaw cycles.

Stability & Storage

The stability of lyophilized protein is crucial for its storage. It is recommended to store lyophilized protein at a temperature below -20°C. However, if necessary, the protein can be kept at room temperature for a short period of 3 weeks without significant degradation.
On the other hand, once the lyophilized protein is reconstituted into a solution, it needs to be handled differently. The reconstituted protein solution should be stored at a temperature range of 4-7°C. This ensures its stability for a moderate duration of 2-7 days.
To extend the storage life of the reconstituted protein solution, it is advisable to aliquot it into smaller portions and store them at a temperature below -20°C. These aliquots can maintain their integrity for up to 3 months, allowing for longer-term storage and subsequent use.
In summary, careful storage management is required for both lyophilized and reconstituted proteins. Control the temperature conditions appropriately to maintain their stability and functional properties.

Target

Background

CD14 is a cell surface glycoprotein that is preferentially expressed on monocytes/macrophages. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a pattern recognition receptor that binds lipopolysaccharides (LPS) and a variety of ligands derived from different microbial sources. The binding of CD14 with LPS is catalyzed by LPS binding protein (LBP). Toll like receptors have also been implicated in the transduction of CD14-LPS signals. Soluble CD14 can be released from the cell surface by phosphatidyinositolspecific phospholipase C and has been detected in serum and body fluids. High concentrations of soluble CD14 have been shown to inhibit LPS mediated responses. However, soluble CD14 can also potentiate LPS response in cells that do not express cell surface CD14.

Accession

P08571