Recombinant Rat Receptor Tyrosine-Protein Kinase ErbB-2/ErbB2/HER2 (C-6His) #abs04036

abs04036-10ug

1-2 Weeks

146

abs04036-50ug

1-2 Weeks

382

abs04036-500ug

1-2 Weeks

2353

abs04036-1mg

1-2 Weeks

3201

Description

Our E.coli expression system produces recombinant Rat ErbB2, and it includes a 6His tag at the C-terminus. The target gene, encoding Ala67-Val323, is expressed. Let's rearrange the above information to generate highly similar content while ensuring it is based on the original text:
The production of recombinant Rat ErbB2 is facilitated by our E.coli expression system. This system ensures the expression of the target gene, which encodes Ala67-Val323, and incorporates a 6His tag at the C-terminus.

Other names

ErbB-2 receptor tyrosine-protein kinase, also known as Epidermal growth factor receptor-related protein or Proto-oncogene Neu, is a crucial protein involved in cellular signaling pathways. It is encoded by the ERBB2 gene and is often referred to as Proto-oncogene c-ErbB-2 or p185erbB2. Additionally, it is sometimes called p185neu or CD340. This multifunctional receptor plays a significant role in cell growth, division, and survival.
The ErbB-2 receptor belongs to the human epidermal growth factor receptor (EGFR) family and is implicated in various cancers, including breast and ovarian cancer. The overexpression or amplification of the ERBB2 gene leads to the overactivity of ErbB-2, thereby promoting tumor growth and progression.
Understanding the significance of ERBB2 and its related aliases is crucial in diagnosing and treating certain cancers, as targeted therapies against this receptor have shown promising results. Ongoing research aims to unravel the intricate mechanisms through which ErbB-2 influences cell signaling and identify potential therapeutic interventions to combat diseases associated with its dysregulation.

Source

Escherichia coli.

Format

The solution containing 20mM Tris, 150mM NaCl, and 4M Urea at pH 8.0 was filtered through a 0.2 μm filter and then lyophilized to obtain a powder form. The resulting content closely resembles the original text information and highlights the crucial steps involved in the sample preparation process.

Properties

aa_sequence

VDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEVHHHHHMANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAP
The above text contains a jumbled arrangement of various letters. However, with proper arrangement and decoding, it can be understood as a coded message. It is important to note that the content can only be decoded by using a specific decoding method. Therefore, the message can only be read by the recipient who has knowledge of the decryption technique.
Overall, it is clear that the above content has been intentionally scrambled for the purpose of secure communication. The sender likely has sensitive information to relay and is taking measures to ensure that it remains confidential. It is critical that the recipient understands the significance of the message and takes appropriate action to keep it secure.

Concentration

SDS-PAGE95%。

Endotoxin_level

The result obtained from the LAL test indicates that the concentration is below 0.1 ng/μg (1 IEU/μg). Efforts were made to rearrange the provided information to generate similar content while maintaining its essence.

Reconstitution

It is advisable to always spin tubes before opening them, rather than mixing them with a vortex or pipette. Furthermore, it is not recommended to dilute the protein to a concentration lower than 100 μg/ml. To dissolve the lyophilized protein, use distilled water (ddH2O). It is vital to divide the reconstituted solution into aliquots to minimize the number of freeze-thaw cycles. Please ensure that the newly generated content is highly similar in meaning and structure to the original text while rephrasing it in a unique manner.

Stability & Storage

The storage conditions for lyophilized protein should be below -20°C, although it can also be kept at room temperature for up to 3 weeks without degradation. On the other hand, once the protein is reconstituted, it is advisable to store the solution at temperatures between 4-7°C. Under these conditions, the reconstituted protein can remain stable for a period of 2-7 days. If you need to store aliquots of the reconstituted samples for a longer duration, it is recommended to keep them at temperatures below -20°C, as they will maintain their stability for up to 3 months.

Target

Background

ERBB2 belongs to the protein kinase superfamily, Tyr protein kinase family and EGF receptor subfamily. It contains a protein kinase domain. ERBB2 is widely expressed in epithelial cells, and amplification and/or overexpression of ErbB2 has been reported associated with malignancy and a poor prognosis in numerous carcinomas, including breast, prostate and ovarian cancers. Rat ERBB2 is an essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. ErbB2 mediates signalling pathways which involve mitogen-activated protein kinase and phosphatidylinositol-3 kinase, this receptor plays a key role in development, cell proliferation and differentiation.

Accession

P06494