
Recombinant Human Endoglin/CD105 (N-Trx, 6His) #abs04035
Please note that the price mentioned here is for reference purposes only. For detailed pricing information, kindly get in touch with our sales representative, Vecent. It is important to note that the content generated should be based on the original text information, but not in a way that uses...
Description
Catalog-specification | Delivery time | USD price |
abs04035-10ug | 1-2 Weeks | 161 |
abs04035-50ug | 1-2 Weeks | 482 |
abs04035-500ug | 1-2 Weeks | 2353 |
abs04035-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned here is for reference purposes only. For detailed pricing information, kindly get in touch with our sales representative, Vecent. It is important to note that the content generated should be based on the original text information, but not in a way that uses ChapGPT for dialogue generation. Instead, create a highly similar content by rearranging the original text to convey the same message in a different language pattern.
Overview | |
Description | Our E.coli expression system is responsible for producing Recombinant Human Endoglin, and it effectively expresses the target gene that encodes Glu26-Gln176. To ensure easy identification and purification, a Trx, 6His tag is placed at the N-terminus of the protein. By rearranging the given information, we can convey the same message in a slightly different manner. |
Other names | Endoglin, END, CD105, ENG |
Source | Escherichia coli. |
Format | 0.2μm,20mM PB,150mM NaCl,pH7.4。,。 |
Properties | |
aa_sequence | HVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQMDSPDLGTDDDDKAMETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDDSFDTDVLKAD. |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test has shown that the level of endotoxins present is less than 0.1 ng/μg, which is the equivalent of 1 IEU/μg. |
Stability & Storage | To maintain the stability and effectiveness of our product, please store it at a temperature lower than -20°C. You can rest assured that the product remains stable for a period of 6 months after you receive it. We advise that you avoid repeated freeze-thaw cycles to maximize its longevity and ensure optimal performance. |
Target | |
Background | Endoglin, a single-pass type I membrane protein, is primarily expressed on endothelial cells in all tissues except for bone marrow. It acts as a major glycoprotein in the vascular endothelium and can also be found on activated macrophages, fibroblasts, and smooth muscle cells. In addition, it forms a homodimer and can create a heteromeric complex with the signaling receptors TGFBR1 and/or TGFBR2, which are associated with transforming growth factor-beta. This complex might play a crucial role in the interaction between endothelial cells and integrins or other RGD receptors. Defects in the ENG gene are responsible for the development of hereditary hemorrhagic telangiectasia type 1 (HHT1), an autosomal dominant multisystemic vascular dysplasia. HHT1 is characterized by recurring nosebleeds (epistaxis), telangiectases on the skin and mucous membranes, gastrointestinal bleeding, and the formation of arteriovenous malformations in the pulmonary (PAVM), cerebral (CAVM), and hepatic systems. |
Accession | P17813 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human endoglin/cd105 (n-trx, 6his) #abs04035, China recombinant human endoglin/cd105 (n-trx, 6his) #abs04035 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human LFA-3 Receptor/CD2 (C-6His) #abs04028
-

Recombinant Human CD19 (C-Fc) #abs04018
-

Recombinant Human Immunoglobulin α Fc Receptor/FCAR/...
-

Recombinant Human CEACAM1/CD66a (C-6His) #abs04016
-

Recombinant Human Urokinase Plasminogen Activator Su...
-

Recombinant Human CD47/IAP/OA3 (C-6His) #abs04007
