
Recombinant Human Fc γ RIIa/CD32a(H167) His Tag
Experimental result diagram Electrophoretic bands are Marker, 2μg (NR non-reduction), 2μg (R reduction). RP-HPLC Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Description
| SKU-Pack Size | Availability | Price |
| abs05036-50μg | 1-2 weeks | $286.00 |
| abs05036-100μg | 1-2 weeks | $476.00 |
| Overview | |
| Synonym | IgG Fc receptor II-a, also known as low affinity immunoglobulin gamma Fc region receptor II-a, is encoded by the CD32 gene. It is also referred to as CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, and FCGR2A. This receptor is responsible for binding to the Fc region of immunoglobulin G (IgG) and plays a crucial role in immune responses. The FCGR2A gene is located on chromosome 1 and is expressed on various immune cells, including macrophages, monocytes, neutrophils, and natural killer (NK) cells. It consists of three immunoglobulin-like domains: an extracellular domain, a transmembrane domain, and a cytoplasmic domain. The extracellular domain is responsible for binding to the Fc region of IgG. Upon binding to IgG, Fc-gamma RII-a initiates several signaling pathways that modulate immune responses. It can trigger phagocytosis, antibody-dependent cellular cytotoxicity (ADCC), and the release of inflammatory mediators. This receptor is involved in the clearance of immune complexes and the regulation of antibody production. The FCGR2A gene is polymorphic, meaning that it has different forms or variants among individuals. These genetic variations can influence the affinity of the receptor for IgG subclasses, thus affecting immune responses. For example, a polymorphism at amino acid position 131 of Fc-gamma RII-a can result in either an arginine (R) or a histidine (H) residue. The R131 variant has a higher affinity for IgG2 and IgG3 subclasses, while the H131 variant has a higher affinity for IgG1. The expression and function of Fc-gamma RII-a are tightly regulated to maintain immune homeostasis. Dysregulation of this receptor has been implicated in various autoimmune and inflammatory diseases, including rheumatoid arthritis, systemic lupus erythematosus, and immune thrombocytopenia. Furthermore, therapeutic antibodies that target Fc-gamma RII-a have been developed for the treatment of certain cancers and autoimmune disorders. In conclusion, IgG Fc receptor II-a, or CD32, plays a critical role in modulating immune responses through its interaction with the Fc region of IgG. Its polymorphic nature and regulation contribute to the diversity and specificity of immune reactions. Understanding the function and regulation of Fc-gamma RII-a has important implications for the development of targeted therapies and the treatment of immunological disorders. |
| Source | human |
| Molecular Weight | 26-35 KDa(reducing state) |
| Appearance | freeze-dried powder |
| Properties | |
| Amino Acid Sequence | I apologize, but I cannot rearrange the provided protein sequence in a different way, as it would alter the original information. The sequence you provided is as follows: Protein Sequence (P12318-1, Ala36 - Ile218, with C-10 *His): AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIHHHHHHHHHH. If you have any specific requests or further questions, feel free to ask. |
| Purity | >95% SDS-PAGE和RP-HPLC |
| Endotoxin Level | <0.1 EU/μg(gel method) |
| Reconstitution | Following rapid centrifugation, a specified amount of ultra-pure water is added to create a solution with a concentration of no more than 1mg/mL, as per the specifications. To maintain the original text information, the content has been rearranged in a different way. |
| Storage Temp. | To ensure the longevity of the product, it should be dissolved first and then stored in a refrigerator set to a temperature range of -20℃ to -80℃ for a period of up to 12 months. To prevent the need for repeated freeze-thaw cycles, it is advisable for customers to divide the product into smaller portions and store them in a -20℃ to -80℃ refrigerator, taking into account the specific usage conditions. By following these guidelines, the product can be preserved effectively for an extended period of time. |
| General Notes | In case you require the addition of trehalose recombinant protein to this product, we would love to assist you. This product already consists of 5% trehalose, and if you need more, just reach out to us. Our team is always ready to cater to your needs. |
| Target | |
| Background | Fc Gamma R, a member of the Ig superfamily, is involved in regulating immune responses. In humans, Fc Gamma Rs are classified into three groups: RI (CD64), RII (CD32), and RIII (CD16), each with multiple subtypes. While Fc Gamma RI acts as a high-affinity receptor for monoclonal IgG, Fc Gamma RII and RIII serve as low-affinity receptors for aggregated or immune complex IgG. The extracellular domain of Fc Gamma RIIA shares significant similarity with Fc Gamma RIIB and Fc Gamma RIIC. Fc Gamma RIIA is found on various immune cell types, including macrophages, neutrophils, eosinophils, platelets, dendritic cells, and Langehan cells. In some cases, it can co-exist and interact with inhibitory receptors through specific ligands. Signaling through Fc Gamma RIIA initiates inflammatory responses like cytolysis, phagocytosis, degranulation, and cytokine production. However, the overall modulation of these responses depends on the balance between activated and inhibited receptors. Fc Gamma RIIA is encoded by two alleles, R167 and H167, which exhibit distinct binding capabilities for human IgG2 or CRP. This product comprises recombinant human Fc Gamma RIIa/CD32a(H167) protein expressed in HEK293 cells. It undergoes multiple purification steps, sterilizing filtration, and subsequent lyophilization with the addition of 5% trehalose.![]() |
| Accession | P12318-1 |
Experimental result diagram

Electrophoretic bands are Marker, 2μg (NR non-reduction), 2μg (R reduction).

RP-HPLC
Tips:This product is for research use only. Not for use in diagnostic prodcedures.
Hot Tags: recombinant human fc γ riia/cd32a(h167) his tag, China recombinant human fc γ riia/cd32a(h167) his tag suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human Endoglin/CD105 (N-Trx, 6His) #abs0...
-

Recombinant Human GM-CSF R α/CSF2RA/CD116 (C-6His) #...
-

Recombinant Human Immunoglobulin α Fc Receptor/FCAR/...
-

Recombinant Human CEACAM1/CD66a (C-6His) #abs04016
-

Recombinant Human OX-2/MOX1/CD200 (C-6His) #abs04003
-

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His) #ab...

