Recombinant Human CD79B/B29 (C-6His) #abs04023

abs04023-10ug

1-2 Weeks

230

abs04023-50ug

1-2 Weeks

673

abs04023-500ug

1-2 Weeks

2353

abs04023-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system enables us to produce Recombinant Human CD79B. The target gene, which encodes Ala29-Asp159, is expressed with a 6His tag at the C-terminus. This ensures the production of a highly similar protein with the desired characteristics.

Other names

The B-Cell Antigen Receptor Complex-Associated Protein Beta Chain, also known as B-Cell-Specific Glycoprotein B29 or Ig-Beta, is an essential component of the B-cell receptor complex. It is responsible for transmitting signals from the B-cell receptor to the interior of the cell, regulating B-cell signaling and activation. The protein is also known as Immunoglobulin-Associated B29 Protein, CD79b, CD79B, B29, or IGB.
B-cell receptor signaling plays a crucial role in the development, activation, and differentiation of B-cells. The B-cell receptor complex, consisting of the B-cell antigen receptor (BCR) and its associated proteins, is responsible for recognizing and binding to specific antigens. Upon binding, the BCR complex is internalized, and its associated proteins, including B29, transmit signals to the interior of the cell.
B29 is expressed primarily in B-cells, where it functions as a critical component of the B-cell receptor complex. It is involved in the phosphorylation and activation of downstream molecules, leading to the initiation of signaling cascades that regulate various cellular processes, including proliferation, differentiation, and apoptosis.
Mutations in the gene encoding B29 have been associated with various immune system disorders, including agammaglobulinemia, a condition characterized by the absence of circulating B-cells and low levels of immunoglobulins. This underlines the important role played by B29 in B-cell development and immune function.
In summary, B-Cell Antigen Receptor Complex-Associated Protein Beta Chain, B-Cell-Specific Glycoprotein B29, Ig-Beta, Immunoglobulin-Associated B29 Protein, CD79b, CD79B, B29, or IGB is a critical component of the B-cell receptor complex, responsible for regulating B-cell signaling and activation and is instrumental in the development of the immune system.

Source

Human Cells

Format

The solution containing 20mM PB and 150mM NaCl, adjusted to pH 7.4, was filtered through a 0.2 μm membrane and subsequently lyophilized.

Properties

aa_sequence

QSQKGLARNLEKCERINTNWMLVQSMSKISKQPDEMQEWLWKGSGASCYKPRNYRDAQRRFKGAIKYVHMTNSGNEVQSWGERLKLPQLKEMRNTEE MGMESLENQSEAQLTTIQGFYKRDFNICQCQSNTVEYGCGTLMRQLVKSTFAQLKTRNTVDVHDHHHHHH，，。

Concentration

The level of purity was established to be above 95% after conducting SDS-PAGE analysis. I can reorganize this information to produce a similar content that conveys the same message but in different words. For instance, the SDS-PAGE assessment revealed a high level of purity exceeding 95%. Alternatively, the results of the SDS-PAGE analysis indicated that the sample was over 95% pure.

Endotoxin_level

The LAL test has determined the presence of less than 0.1 ng/μg (1 IEU/μg) in the sample. This information serves as an important indication that the sample is of high quality and meets necessary standards.

Reconstitution

Prior to opening, always make sure to centrifuge the tubes first. Avoid using vortex or pipetting to mix the contents. It is strongly advised to not reconstitute the protein at a concentration lower than 100 μg/ml. Start the reconstitution process by dissolving the lyophilized protein with ddH2O. To prevent freeze-thaw damage, make sure to aliquot the reconstituted solution. It is essential to generate similarly written content based on the initial text. Instead of relying on ChapGPT, try using a language model to produce text with distinct variations from the original.

Stability & Storage

The recommended storage temperature for lyophilized protein is below -20°C. However, if necessary, the protein can be kept at room temperature for up to 3 weeks. After reconstitution, the protein solution can be stored at 4-7°C for a period of 2-7 days. If you need to keep the sample for a longer period, aliquots of the reconstituted protein can be stored below -20°C for up to 3 months. This way, you can conveniently store your samples without worrying about their stability and activity.

Target

Background

CD79B is a single-pass type I membrane protein. CD79B contains one Ig-like V-type domain and one ITAM domain. CD79B is required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR), which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79B enhances phosphorylation of CD79A, possibly by recruiting kinases that phosphorylate CD79A or by recruiting proteins that bind to CD79A and protect it from dephosphorylation.

Accession

P40259