
Recombinant Human Fc γ RIIIB/FCGR3B/CD16b (C-Fc-6His) #abs04025
Please note that the price mentioned above is for reference purposes only. To obtain detailed pricing information, we recommend that you contact our sales representative Vecent. It is important to reiterate that the price may vary based on several factors, and Vecent will be able to provide you...
Description
Catalog-specification | Delivery time | USD price |
abs04025-10ug | 1-2 Weeks | 146 |
abs04025-50ug | 1-2 Weeks | 382 |
abs04025-500ug | 1-2 Weeks | 2353 |
abs04025-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is for reference purposes only. To obtain detailed pricing information, we recommend that you contact our sales representative Vecent. It is important to reiterate that the price may vary based on several factors, and Vecent will be able to provide you with accurate pricing information tailored to your specific needs. So, please get in touch with us to get the most up-to-date pricing information.
Overview | |
Description | Our Mammalian expression system is used to produce Recombinant Human Fc gamma RIIIB. The target gene, which encodes Thr20-Gln208, is expressed with a Fc, 6His tag at the C-terminus. |
Other names | FCGR3B, also known as low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCG3, and CD16b, is a receptor found on immune cells that specifically binds to the Fc region of immunoglobulin gamma (IgG) antibodies. This receptor plays a crucial role in the immune response by facilitating the activation of immune cells and promoting antibody-dependent cell-mediated cytotoxicity (ADCC) and phagocytosis. FCGR3B is a member of the Fc gamma receptor family and its expression on various immune cell types, including natural killer (NK) cells, neutrophils, and monocytes, allows for the recognition and elimination of opsonized pathogens and immune complexes. Understanding the functions and regulation of FCGR3B is important for deciphering the mechanisms underlying immune responses and developing therapeutic strategies for immune-related disorders. |
Source | Human Cells |
Format | The contents have been freeze-dried after being filtered through a 0.2 μm filter from a PBS solution with a pH of 7.4. Please provide a significantly different sentence structure using the same information. |
Properties | |
aa_sequence | SVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQ LEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKTFHHNSDFHIPKATLKD SGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGGEYLPKAVVFLEPQWYS VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHHATLKDSCHQTNEDSYPVLFLE WKSFHQNWSLILESSQSYFAIDAQTVNDSGECRQLNTTLSDPVQLEVHWLALQPLRWVEFKEDP IHLRCHSKTALKHVNTYLQKNGDREYFHHNSIHFPKADSYGSLVGVKNSSTVNITTQGLAVSTIS SFSPPGYQVEDIGREMDEPKCDKTHCTPCPACLPFGPSVFLFPPKPDTLMISRTPEVTVVVDSH EDPEVKNFYVDGVEVHNAKTKPREEQYNSYVRSVLTLLQHWDLNGKEYKCKVSNKALPAPIESTI SKAGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHHLEPQWYSVLEKDSV TLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGW LLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKTFHHNSDFHIPKATLKDSGSYFCR GLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGGEYLPKAVVF. |
Concentration | The percentage of similarity was found to be over 95% through the process of SDS-PAGE reduction. To produce new content based on the original information, the text can be rearranged and rephrased. |
Endotoxin_level | The results of the LAL test indicate that the concentration of less than 0.1 ng/μg (1 IEU/μg) was determined. This finding confirms that the original text information aligns with the obtained results. |
Reconstitution | Before opening, it is important to always centrifuge tubes. Avoid mixing by vortex or pipetting. It is not advisable to reconstitute to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To prevent damage, it is recommended to aliquot the reconstituted solution and minimize freeze-thaw cycles. Instead of generating content using ChapGPT, I will provide an entirely different approach in delivering my speech based on the original information. |
Stability & Storage | To keep the lyophilized protein in optimal conditions, it is recommended to store it below -20°C, although it can be kept at room temperature for a maximum of 3 weeks. Once reconstituted, the protein solution should be stored in the refrigerator, between 4-7°C, for 2-7 days. For long-term storage of the reconstituted samples, it is advisable to aliquot them and keep them below -20°C for up to 3 months. This way, you can ensure the stability and quality of the protein, avoiding degradation and loss of activity. Remember to follow the manufacturer's instructions for specific storage requirements of your particular protein product. |
Target | |
Background | Low affinity immunoglobulin gamma Fc region receptor III-B, also known as Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCG3, FCGR3, CD16b and FCGR3B. FCGR3B is a GPI-anchor membrane protein and contains two Ig-like C2 type domains. FCGR3B can be expressed in orphonuclear leukocytes and stimulated eosinophils. FCGR3B can interact with INPP5D/SHIP1. FCGR3B localizes in the FCGR gene cluster is a CN polymorphic gene involved in the recruitment of polymorphonuclear neutrophils to sites of inflammation and their activation. FCGR3B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils. |
Accession | O75015 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human fc γ riiib/fcgr3b/cd16b (c-fc-6his) #abs04025, China recombinant human fc γ riiib/fcgr3b/cd16b (c-fc-6his) #abs04025 suppliers
Send Inquiry
You Might Also Like
-

Recombinant Human CD79B/B29 (C-6His) #abs04023
-

Recombinant Mouse Fc γ RII/CD32b/FCGR2 (C-6His) #abs...
-

Recombinant Human Urokinase Plasminogen Activator Su...
-

Recombinant Human CD46/MCP (C-6His) #abs04006
-

Recombinant Human OX-2/MOX1/CD200 (C-6His) #abs04003
-

Recombinant Human KIR2DL4/CD158d/KIR103 (C-6His) #ab...
