Recombinant Mouse Fc γ RII/CD32b/FCGR2 (C-6His) #abs04021

abs04021-10ug

1-2 Weeks

146

abs04021-50ug

1-2 Weeks

382

abs04021-500ug

1-2 Weeks

2353

abs04021-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is used to produce Recombinant Mouse Fc gamma RII, which is expressed with a 6His tag at the C-terminus. The target gene encoding Thr30-Pro210 is utilized for expression, resulting in a highly purified product. The recombinant protein is almost identical to the endogenous Fc gamma RII found in mice, making it an excellent tool for studying immune system function and antibody-mediated responses. With this high-quality protein, researchers can conduct in-depth investigations and gain a better understanding of various immunological processes.

Other names

Fc gamma receptor IIB, also known as Fc-gamma-RIIB, FcRII, or CD32, is a low affinity immunoglobulin gamma Fc region receptor II that plays a crucial role in the regulation of immune responses. This receptor binds to the Fc portion of immunoglobulin G (IgG) and functions as a negative regulator of B cell activation and antibody production. Fc gamma receptor IIB is expressed on various immune cells, including B cells, macrophages, neutrophils, and dendritic cells.
Recent studies have shown that Fc gamma receptor IIB is also involved in the pathogenesis of various autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis. Furthermore, Fc gamma receptor IIB has been identified as a potential therapeutic target for the treatment of cancer and infectious diseases.
Fc-gamma-RIIB is also known as IgG Fc receptor II beta, lymphocyte antigen 17 (Ly-17), or Fcgr2b. The protein structure of Fc gamma receptor IIB includes two immunoglobulin-like domains and a cytoplasmic tail containing immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The ITIMs recruit phosphatases that negatively regulate signaling pathways downstream of B cell receptors and other immune receptors.
In summary, Fc gamma receptor IIB is a versatile immune receptor that contributes to the regulation of immune responses and the pathogenesis of various diseases. Further research on the structure and function of Fc gamma receptor IIB could lead to new therapeutics for the treatment of immune-related disorders.

Source

Human Cells

Format

The content has been lyophilized from a solution of PBS with a pH of 7.4, which was previously filtered through a 0.2 μm filter.

Properties

aa_sequence

TVQAKVTNLWIPYYDEKQGSEVFSNLRHHNSKYEQYIHSVRFLNETGIRWLTSEDLVLCDTKGQVPTNSSGHGWRQPVTLKSNDCSKTAIFYRQGVENWCEDPMLDHHHHHHSSSSRRQSIKVFGTSLNFEKHNFFSRINLLRKWNRSCHLTITEGELFVLPQTQWLLWSDIVLGVDPDSLSRQMEQRYCGENGNSHPTGTHNCYFSTGVAQSYIQNVKPASHFSNYSHYHHK.

Concentration

SDS-PAGE，95%。，。
SDS-PAGE，95%。

Endotoxin_level

The LAL test determined that the level of less than 0.1 ng/μg (1 IEU/μg) meets the required criteria. Let's generate a highly paraphrased version of the original information using a different language style.

Reconstitution

Before opening, always remember to centrifuge tubes. Avoid mixing by vortexing or pipetting. It is strongly advised not to reconstitute the protein to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. To minimize freeze-thaw cycles, it is important to aliquot the reconstituted solution. Please note that generating content in a completely different manner from ChapGPT is recommended to ensure language model output is substantially distinct from the original text information.

Stability & Storage

To properly store lyophilized protein, it is recommended to keep it at temperatures below -20°C. However, it can also remain stable at room temperature for three weeks. If you have a reconstituted protein solution, it should be kept at 4-7°C and can last for 2-7 days. For long-term storage, it is best to divide the reconstituted sample into smaller aliquots and store them at temperatures below -20°C. These aliquots can then be stored for up to three months.

Target

Background

Low affinity immunoglobulin gamma Fc region receptor II (CD32B) is a single-pass type I membrane protein and contains 2 Ig-like C2-type (immunoglobulin-like) domains. The inhibitory CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis. Co-ligation of CD32B on dendritic cells inhibits maturation and blocks cell activation. CD32B may also be a target formonoclonal antibody therapy for malignancies.

Accession

P08101