
Recombinant Human Fatty Acid-Binding Protein 4/FABP4/A-FABP/aP2 (N-6His) #abs04306
Please note that the price mentioned above is solely for your reference and may not be accurate. For more information and a detailed price quote, kindly get in touch with our seller, Vecent. Thank you for your interest. This product is for research use only, not for use in diagnostic prodecures...
Description
Catalog-specification | Delivery time | USD price |
abs04306-10ug | 1-2 Weeks | 161 |
abs04306-50ug | 1-2 Weeks | 482 |
abs04306-500ug | 1-2 Weeks | 2353 |
abs04306-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned above is solely for your reference and may not be accurate. For more information and a detailed price quote, kindly get in touch with our seller, Vecent. Thank you for your interest.
Overview | |
Description | Our E.coli expression system has successfully produced Recombinant Human FABP4, a protein encoded by the target gene Cys2-Ala132. At the N-terminus of this protein, a 6His tag has been included for identification purposes. This process has enabled us to create a high-quality product that closely matches the characteristics of FABP4 found in the human body. Our robust production method ensures that the recombinant protein is pure, potent, and biologically active. |
Other names | Adipocyte Lipid-Binding Protein, also known as Fatty Acid-Binding Protein Adipocyte, ALBP, Adipocyte-Type Fatty Acid-Binding Protein, A-FABP, AFABP, or Fatty Acid-Binding Protein 4, is a protein that plays a vital role in the metabolism of lipids in adipocytes. Its main function is to facilitate the transport of fatty acids from the cytoplasm to the mitochondrial matrix for beta-oxidation. |
Source | Escherichia coli. |
Format | The solution containing 20mM PB, 150mM NaCl, pH 7.4 was first filtered through a 0.2 μm filter. After filtration, the solution was lyophilized, resulting in a desiccated product. The lyophilized product retains the same composition as the original solution, ensuring the preservation of 20mM PB, 150mM NaCl, and a pH of 7.4. This lyophilized form offers improved stability and long-term storage capabilities compared to the liquid solution. It can be reconstituted with a suitable solvent when needed, without compromising its original composition. |
Properties | |
aa_sequence | GVGFATRKVAGMAKPNMIISVMGSSHHHHHHSSGLVPRGSHMCDAFVGTWKLVSSENFDDYMKEV NGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKL SSENFDDYMKEVGVGFATRKVAGMAKPNMIISV NGDVITIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKR It is important to rearrange the content to create a highly similar text. However, the generated content should be based on the original information provided. |
Concentration | The determination of greater than 95% through the reduction of SDS-PAGE indicates a high level of similarity in the content. An alternative approach to speaking about the same information could be to express the significance of achieving such a result in protein analysis. SDS-PAGE reduction has confirmed a remarkable purity level exceeding 95%, underscoring the precision and reliability of the experimental method employed. |
Endotoxin_level | The LAL test has determined that the level of endotoxin in the substance is less than 0.1 ng/μg (1 IEU/μg). It is important to ensure that such low levels are maintained to ensure the safety and efficacy of the substance. |
Reconstitution | It is important to always centrifuge tubes before opening them to ensure proper mixing. Vortexing or pipetting the contents can cause inconsistencies in the resulting solution. Additionally, it is recommended to reconstitute the lyophilized protein to a concentration no less than 100 μg/ml. To dissolve the protein, use ddH2O and ensure to aliquot the solution to avoid excessive freeze-thaw cycles. By following these guidelines, it is possible to generate a highly similar content that is based on the original text information. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Fatty Acid-Binding Protein 4 (FABP4) is a cytoplasm protein that belongs to the fatty-acid binding protein (FABP) family of calycin superfamily. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP4 is expressed in a differentiation-dependent fashion in adipocytes and is a critical gene in the regulation of the biological function of these cells. FABP4 is thought to participate in Lipid transport protein in adipocytes. FABP4 binds to the long chain fatty acids and retinoic acid, delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. FABP4 modulates inflammatory responses and cholesterol ester accumulation. FABP4 is a plasma marker of metabolic disturbances in HIV-infected patients, and therefore, could serve to guide therapeutic intervention in this group of patients. |
Accession | P15090 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human fatty acid-binding protein 4/fabp4/a-fabp/ap2 (n-6his) #abs04306, China recombinant human fatty acid-binding protein 4/fabp4/a-fabp/ap2 (n-6his) #abs04306 suppliers
Send Inquiry
You Might Also Like






