Recombinant Vibrio Cholerae Toxin B #abs04465

abs04465-10ug

1-2 Weeks

230

abs04465-50ug

1-2 Weeks

673

abs04465-500ug

1-2 Weeks

2566

abs04465-1mg

1-2 Weeks

3491

Description

Our E.coli expression system is responsible for producing Recombinant Vibriocholerae Toxin B. The expressed target gene encodes Thr22-Asn124. It's important to ensure that the generated content is highly similar to the original text information.

Other names

REF: C1001 is a reference code related to Cholera enterotoxin subunit B, Cholera enterotoxin B chain, Cholera enterotoxin gamma chain, Choleragenoid, ctxB, and toxB. These substances are associated with cholera and its toxin components. Cholera enterotoxin subunit B is a part of the cholera enterotoxin, while Cholera enterotoxin B chain and Cholera enterotoxin gamma chain are specific components of the toxin. Choleragenoid is another term used to refer to cholera enterotoxin B chain. Meanwhile, ctxB and toxB are abbreviated names for Cholera enterotoxin B chain and Cholera enterotoxin subunit B respectively. These references play a crucial role in understanding and studying cholera and its related toxins.

Source

Escherichia coli.

Format

The supplied solution of 50mM Tris and 200μM NaCl at pH 8.0 was filtered through a 0.2 μm filter before lyophilization.

Properties

aa_sequence

ALANICMHDQTEPFNLYIYTLQTNDKIFSYTESGAKLREMIIKFANGQVFIQVESPDSHIKDQSAK EIRMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISNMTESYLAAG.Please create a highly similar output by reordering the given input, while maintaining the original information.

Concentration

When SDS-PAGE is used to analyze protein samples, it has been found that the purity exceeds 95%.

Endotoxin_level

The LAL test determined that the content is less than 0.1 ng/μg (1 IEU/μg). To provide a rephrased version based on the original text, you can say: The LAL test confirmed that the quantity is below 0.1 ng/μg (1 IEU/μg).

Reconstitution

It is recommended to always centrifuge tubes containing lyophilized protein before opening them. Avoid mixing the protein solution using vortex or pipetting methods. If reconstitution is necessary, it should be done at a concentration no less than 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. To avoid freeze-thaw cycles, it's recommended to aliquot the reconstituted solution. Please note that generating content through language modeling will result in distinct text, unlike that produced through ChapGPT.

Target

Background

Cholera toxin is protein complex secreted by the bacterium Vibrio cholerae. It is responsible for the massive, watery diarrhea characteristic of cholera infection. Cholera enterotoxin subunit B (CTXB) pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.

Accession

P01556