
Recombinant Human VEGF Receptor 1/VEGF R1/FLT-1 (C-Fc) #abs04464
Please note that the provided price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. Kindly note that the content generated should not be based on the original text information or follow the conversation style of ChapGPT, but rather be...
Description
Catalog-specification | Delivery time | USD price |
abs04464-10ug | 1-2 Weeks | 138 |
abs04464-50ug | 1-2 Weeks | 382 |
abs04464-500ug | 1-2 Weeks | 1604 |
abs04464-1mg | 1-2 Weeks | 2328 |
Please note that the provided price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. Kindly note that the content generated should not be based on the original text information or follow the conversation style of ChapGPT, but rather be distinctly different, showcasing the capabilities of the language model.
Overview | |
Description | Our Mammalian expression system successfully produces Recombinant Human Vascular Endothelial Growth Factor Receptor 1. The gene responsible for encoding Ser27-Asn756 is expressed with a Fc tag at the C-terminus. |
Other names | VEGFR-1, also known as Fms-like tyrosine kinase 1 or FLT-1, is a tyrosine-protein kinase receptor that plays a crucial role in vascular permeability and growth factor signaling. It is often referred to as the vascular permeability factor receptor. VEGFR-1 is an essential component of the VEGF signaling pathway, regulating angiogenesis and vasculogenesis processes. It functions by binding to vascular endothelial growth factor (VEGF) and initiating downstream signaling cascades. |
Source | Human Cells |
Format | The solution of PBS, pH 7.4, was passed through a 0.2 μm filter and then lyophilized to obtain the final product. |
Properties | |
aa_sequence | LQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTSKLKDPELSLKGTQHIMQAGQTLHLT LTNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELV IPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTN YLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQ SSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFN LTA TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFC SNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRN ISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAIT KEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISS STTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGSVE SSAYLTVQGTSDKSNVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Concentration | Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin_level | Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Human Vascular endothelial growth factor receptor 1 (VEGFR-1, FLT-1) is a member of the the class III subfamily of receptor tyrosine kinases (RTKs) and Tyr protein kinase family and CSF-1/PDGF receptor subfamily. VEGFR-1 is widely expressed in human tissues including normal lung, placenta, liver, kidney, heart and brain tissues. It is specifically expressed in most of the vascular endothelial cellsand peripheral blood monocytes. VEGFR-1 contains seven Ig-like C2-type domains and one protein kinase domain. VEGFR-1is an essential receptor tyrosine kinase and plays an important role in theregulation of VEGF family-mediated vasculogenesis, angiogenesis, and lymphangiogenesis. It is also mediators of neurotrophic activity and regulators of hematopoietic development. VEGFR-1 is a receptor for VEGF, VEGFB and PGF. It has a tyrosine-protein kinase activity. Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFB and PGF. It may play an essential role as a negative regulator of embryonic angiogenesis by inhibiting excessive proliferation of endothelial cells and promote endothelial cell proliferation, survival and angiogenesis in adulthood. Its function in promoting cell proliferation seems to be cell-type specific. VEGFR-1 can also promote PGF-mediated proliferation of endothelial cells, proliferation of some types of cancer cells, but does not promote proliferation of normal fibroblasts (in vitro). |
Accession | P17948 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human vegf receptor 1/vegf r1/flt-1 (c-fc) #abs04464, China recombinant human vegf receptor 1/vegf r1/flt-1 (c-fc) #abs04464 suppliers
Send Inquiry
You Might Also Like






