Recombinant Mouse Interleukin-18/IL-18/IL-1F4 (N-6His) #abs04467

abs04467-10ug

1-2 Weeks

161

abs04467-50ug

1-2 Weeks

482

abs04467-500ug

1-2 Weeks

2353

abs04467-1mg

1-2 Weeks

3201

Description

Our E.coli expression system is utilized to produce Recombinant Mouse Interleukin-18. The target gene, which encodes Asn36-Ser192, is expressed with a 6His tag positioned at the N-terminus. To ensure accuracy and relevance, please provide me with specific details or inquiries about the content mentioned above.

Other names

IL-18, also known as Interferon gamma-inducing factor or IFN-gamma-inducing factor, is a type of cytokine that plays a key role in immune system regulation. It was previously known as Interleukin-1 gamma or IL-1 gamma and was also referred to as Igif.
IL-18 has been shown to activate a wide range of immune cells, including T cells, NK cells, and macrophages. It is involved in the stimulation of the interferon gamma pathway, which is responsible for the production of enzymes and proteins that help fight off viral infections and other diseases.
Studies have shown that IL-18 is involved in a number of inflammatory diseases, including rheumatoid arthritis, asthma, and inflammatory bowel disease. It has also been linked to the development of certain types of cancer.
Overall, IL-18 is an important cytokine that plays a key role in immune system regulation and the body's ability to fight off disease. Its precise mechanisms of action are still being studied, but it is clear that it plays a critical role in maintaining immune system health.

Source

Escherichia coli.

Format

pH 8.0, a solution containing 20mM Tris, 1mM EDTA, 2mM DTT, and 5% Trehalose was filtered through a 0.2 μm filter and subsequently lyophilized.

Properties

aa_sequence

GLHQKTMHEDEIKKKKVSFSNCDKLTSVMKGDLIEESQFPLVSDQVYFRNITARLVVDMQVFKVDTYRGAPLEVLMYIDIFSSGIKTCVLNQDKRCEQFAKDPRLINSLFQUEMYDKWTEHRGSSVMAIKSDDKIZFTNEPVHQMLTLFLHKN.TDTIQVHILMPDDIDNSMKEELRSVYLIGAVKSKVECALSEFGMLNSEQKAFPYHHNSRCFQEKLAKNKD

Concentration

Reducing SDS-PAGE has determined that the protein concentration is greater than 95%. To elucidate further, the analysis indicates that the majority of the sample consists of the desired protein. This high concentration demonstrates the efficiency and effectiveness of the SDS-PAGE technique in separating and quantifying proteins.

Endotoxin_level

The LAL test has determined that the level of contamination is less than 0.1 ng/μg (1 IEU/μg). Please create text that closely resembles this information by rearranging the words in the original content. It is important to ensure that the generated content is based on the information provided in the original text, but does not simply replicate it.

Reconstitution

To ensure proper handling of your sample, it's important to always centrifuge tubes containing lyophilized protein before opening. Avoid mixing the sample by vortex or pipetting, as this can compromise the integrity of the protein. Additionally, it's recommended to reconstitute the sample to a concentration of at least 100 μg/ml. To do so, dissolve the lyophilized protein in deionized water (ddH2O). It's also important to aliquot the reconstituted solution to minimize both contamination and freeze-thaw cycles. By following these guidelines, you can ensure the reliable and accurate handling of your sample.

Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Target

Background

Interleukin-18 (IL18, also known as interferon-gamma inducing factor) is a protein which in mouse is encoded by the IL18 gene, belongs to the IL-1 family. Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Accession

P70380