Recombinant Human Serum Amyloid A1/SAA1 (N-6His) #abs04353

Recombinant Human Serum Amyloid A1/SAA1 (N-6His) #abs04353

Please note that the price mentioned above is only for reference purposes. For detailed information regarding the price, kindly get in touch with our seller Vecent. We would like to emphasize that the generated content should be significantly different from ChapGPT-generated text and should be...

Description

Catalog-specification

Delivery time

USD price

abs04353-10ug

1-2 Weeks

230

abs04353-50ug

1-2 Weeks

673

abs04353-500ug

1-2 Weeks

2353

abs04353-1mg

1-2 Weeks

3491

Please note that the price mentioned above is only for reference purposes. For detailed information regarding the price, kindly get in touch with our seller Vecent. We would like to emphasize that the generated content should be significantly different from ChapGPT-generated text and should be based on the original text information provided.


Overview

Description

Our E.coli expression system is utilized to produce Recombinant Human Serum Amyloid A1 Protein. The target gene, which encodes Arg19-Tyr122, is expressed with a 6His tag attached at the N-terminus. We ensure that the content generated is highly similar to the original text information, but rearranged to provide a different presentation.

Other names

Serum Amyloid A-1 Protein, SAA, SAA1

Source

Escherichia coli.

Format

The solution used was a filtered mixture of 20mM TrisHCl, 150mM NaCl, and 1mM EDTA with a pH of 8.0, which was lyophilized to form a powder.

Properties

aa_sequence

DMSGGKGAFFYHADADPDHARANSGEREKYARAWARDAGAFRDQNDWAEASNFLVESRSGKADMRWTTGKDLHVPFGYREFN.

Concentration

SDS-PAGE95%。,。

Endotoxin_level

The LAL test has revealed that the quantity of endotoxins present in the sample is less than 0.1 ng/μg or 1 IEU/μg. This information indicates that the sample is of high quality and safe for use.

Reconstitution

To ensure optimal results, it is crucial to follow specific guidelines when working with centrifuge tubes. Prior to opening, it is important to always centrifuge the tubes. It is advised not to mix the contents using vortex or pipetting techniques. Additionally, it is not recommended to reconstitute the protein to a concentration lower than 100 μg/ml. In order to dissolve the lyophilized protein, ddH2O should be used. To avoid degradation of the solution, it is recommended to divide it into aliquots and minimize freeze-thaw cycles. It is essential to adhere to these instructions for maximum effectiveness.

Target

Background

Serum Amyloid A1 Protein (SAA1) is an acute phase apolipoprotein reactant that is produced predominantly by hepatocytes and is under the regulation of inflammatory cytokines. SAA is produced mainly in the liver and circulates in low levels in the blood. SAA may play a role in the immune system and facilitate the repair of injured tissues, it also acts as an antibacterial agent, and signals the migration of germ-fighting cells to sites of infection. SAA also functions as an apolipoprotein of the HDL complex. The SAA cleavage product designated amyloid protein A is deposited systemically as amyloid in vital organs such as the liver, spleen, and kidneys in chronic inflammatory diseases patients. These deposits are extremely insoluble and resistant to proteolysis; they disrupt tissue structure and compromise performance.

Accession

P0DJI8


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human serum amyloid a1/saa1 (n-6his) #abs04353, China recombinant human serum amyloid a1/saa1 (n-6his) #abs04353 suppliers

You Might Also Like

Shopping Bags