Recombinant Human Nectin-3/PVRL3/CD113 (C-6His) #abs04352

Recombinant Human Nectin-3/PVRL3/CD113 (C-6His) #abs04352

Please note that the price mentioned is only for your reference and for detailed pricing, kindly get in touch with our representative Vecent. We would like to emphasize that the prices may vary based on the products or services you require. Hence, it is recommended to contact our seller for...

Description

Catalog-specification

Delivery time

USD price

abs04352-10ug

1-2 Weeks

123

abs04352-50ug

1-2 Weeks

337

abs04352-500ug

1-2 Weeks

2353

abs04352-1mg

1-2 Weeks

3201

Please note that the price mentioned is only for your reference and for detailed pricing, kindly get in touch with our representative Vecent. We would like to emphasize that the prices may vary based on the products or services you require. Hence, it is recommended to contact our seller for accurate and updated information on pricing. Thank you!


Overview

Description

Our Mammalian expression system is utilized to produce Recombinant Human Nectin-3. The target gene, which encodes Gly58-Cys366, is expressed with a 6His tag at its C-terminus. Let me create a rephrased version of the original information while ensuring it remains faithful to the provided text.

Other names

CDw113, Poliovirus Receptor-Related Protein 3, PRR3, Nectin-3, CD113, and PVRL3 are all names used to refer to the same protein. This protein belongs to a family of proteins that act as receptors for the poliovirus. Specifically, it is involved in the attachment of the poliovirus to host cells, which is the first step in the infection process. However, this protein is also known to play a role in other biological processes, such as cell-cell adhesion, and it is found in a variety of tissues throughout the body. Due to its involvement in both normal and pathological processes, CDw113 is a target of interest for researchers studying the mechanisms of viral infection and disease.

Source

Human Cells

Format

The original solution, containing 20mM PB, 150mM NaCl, and with a pH of 7.4, was filtered through a 0.2 μm filter before undergoing lyophilization. To create a similar content based on this information, one could say:
After undergoing filtration with a 0.2 μm filter, the solution consisting of 20mM PB, 150mM NaCl, and having a pH of 7.4 was subjected to lyophilization.

Properties

aa_sequence

TQGLEPLVHVSKNNKCVTQKGEWNSVVGCIPVGKVRTIEQHSWTIVSKGSFQPKAQHGFEHGYYIQRNS YFGSNDVTLSNITVNGFGYISEVLKHKTCWVFKASQVSTVGITNDDTGGEPIAISTVLCCGLEDND SAAIICITKGGTAHPDWHIEGEMVLSEETSFPITNTSKYVFIRLTRQGFARKVIHKIQETDLYSRIF DDIYLAIPTQSVGSTVENYDWGNGVFKRLVVCGANSLDANPKFSTDPGAWSDGQLPLSSDHIGTTF VNHSLFNYTGLVICNTSGKRQSVDYKLIAASQVHYHDCHHHHHNSHHVLAASELVTAFGKPYELQFD.

Concentration

The protein purity was confirmed to be greater than 95% through SDS-PAGE analysis. A highly comparable statement can be made by rephrasing the original information to say that the SDS-PAGE gel examination revealed a protein purity exceeding 95%.

Endotoxin_level

As detected by the LAL test, the measurement of less than 0.1 ng/μg (1 IEU/μg) is indicative of the content in question.

Reconstitution

Before opening, it is important to always centrifuge tubes. Avoid mixing by using vortex or pipetting methods. Reconstituting the lyophilized protein to a concentration below 100 μg/ml is not recommended. Dissolve the protein in ddH2O. To minimize freeze-thaw cycles, divide the reconstituted solution into smaller aliquots.

Target

Background

Nectin-3 is a type I transmembrane glycoprotein that belongs to the nectin family. Its precursor is 549 amino acids in length and contains an extended signal sequence of 57 amino acids, an extracellular domain (ECD) of 347 amino acids, a transmembrane segment of 21 amino acids, and a cytoplasmic region of 124 amino acids. It is predominantly expressed in testis and placenta as well as in various cell lines, including epithelial cell lines. Nectin-3 plays a role in cell-cell adhesion through heterophilic trans-interactions with nectin-like proteins or nectins, such as trans-interaction with PVRL2/Nectin-2 at Sertoli-spermatid junctions. Nectin-3 is also involved in the formation of cell-cell junctions, including adherens junctions and synapses.

Accession

Q9NQS3


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human nectin-3/pvrl3/cd113 (c-6his) #abs04352, China recombinant human nectin-3/pvrl3/cd113 (c-6his) #abs04352 suppliers

You Might Also Like

Shopping Bags