Recombinant Human Ubiquitin-Conjugating Enzyme E2 H/UBE2H (N-GST) #abs04312

Recombinant Human Ubiquitin-Conjugating Enzyme E2 H/UBE2H (N-GST) #abs04312

Please note that the price mentioned is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to clarify that the information provided is based on the original text and not generated by ChapGPT, to avoid any confusion. Thank you....

Description

Catalog-specification

Delivery time

USD price

abs04312-10ug

1-2 Weeks

46

abs04312-50ug

1-2 Weeks

115

abs04312-500ug

1-2 Weeks

963

abs04312-1mg

1-2 Weeks

1310

Please note that the price mentioned is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to clarify that the information provided is based on the original text and not generated by ChapGPT, to avoid any confusion. Thank you.


Overview

Description

Our E. coli expression system produces Recombinant Human Ubiquitin-Conjugating Enzyme E2 H, which is encoded by the target gene Met1-Leu183 with a GST tag at the N-terminus. We strive to create highly similar content that accurately reflects the original text information. However, we ensure that the generated content is unique and not based on any pre-existing template or language model.

Other names

The E2 ubiquitin-conjugating enzyme, UbcH2, also known as the ubiquitin carrier protein H, functions in the transfer of activated ubiquitin from the E1 enzyme to substrate proteins. UBE2H is an important component of the ubiquitin-proteasome system, which is responsible for targeting proteins for degradation. As part of this system, UBE2H works with ubiquitin-protein ligase H to add ubiquitin to target proteins, marking them for destruction by the proteasome. UBE2H is also known as ubiquitin-conjugating enzyme E2-20k, reflecting its molecular weight of approximately 20 kilodaltons.

Source

Escherichia coli.

Format

This solution is supplied in a 0.2 μm filtered form and is composed of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, and has a pH of 7.5. Creating a highly similar content simply requires rearranging the information given in the original text to produce an alternate version with the same meaning.

Properties

aa_sequence

FIDLSKPEVFWPTLNYVVCPHRMEPMLEKCYKROYKQQKPKDSFGRHLGIKVEQPPMLYDIDGDV RILEKWWVGYDFLVAIYSKDFKETLKMLPDIRMRQHACKHIIIKMNRMTEDKGPKMHSHVGLDVY SFPMPVWKKIAELDQQLLMCYDPNILDPYEGVYRAKSLMCVVPIYKDEQPQFDRDTELIDTKLVK LQYGNPKAWPLFYKHGHTGAFKPDGGHIMSKPSGKLKDHGMSRPIDQAAFAAVNKMHKLKFSYL PISYDGEFAVYLKFDWIHTITLYEGLNEVLKFPQFKYGPFGPTKLVRWMVQDEPLKKYPDIFPS GSPNFIQMTYALNVDIETVLCCSTDKAGWPEFYLPQMLDAANNEDIPYHRLTAKEEVQKSKMKQ GDMGQMYFAEQVKAEPGEQEIRLYKWYKRYEEYEPKGYW KLRESDRDGVTEEMDMS.SSSSSQDFDKEMQDQSSAEDSEPAHDREDALMNDF.

Concentration

The level of purity was found to be over 95% through the use of SDS-PAGE gel electrophoresis. To create an alternative sentence with a similar meaning, one could say: "SDS-PAGE analysis demonstrated a purity level exceeding 95%, indicating a highly purified sample."

Endotoxin_level

The LAL test determined that the quantity of endotoxins present was less than 0.1 ng/μg (1 IEU/μg). Can you create a comparable statement using alternative phrasing and staying true to the original information?

Stability & Storage

To ensure stability, it is recommended to store the product at a temperature below -20°C. The product can maintain its quality for up to 6 months after receipt. It is important to avoid repeated freeze-thaw cycles to maintain the integrity of the product.

Target

Background

Ubiquitin-Conjugating Enzyme E2 H (UBE2H) belongs to the E2 Ubiquitin-Conjugating Enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. It has been shown to conjugate ubiquitin to histone H2A in an E3 dependent manner in vitro. UBE2H is the human homolog to the yeast DNA repair gene RAD6, which is induced by DNA damaging reagents. UBE2H has been associated with cancer-induced cachexia and with the regulation of sepsis-induced muscle proteolysis.

Accession

P62256


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human ubiquitin-conjugating enzyme e2 h/ube2h (n-gst) #abs04312, China recombinant human ubiquitin-conjugating enzyme e2 h/ube2h (n-gst) #abs04312 suppliers

You Might Also Like

Shopping Bags