Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4/UBE2D4 (N-GST) #abs04311

abs04311-10ug

1-2 Weeks

46

abs04311-50ug

1-2 Weeks

115

abs04311-500ug

1-2 Weeks

963

abs04311-1mg

1-2 Weeks

1310

Description

Our E.coli expression system is used to produce Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4. The target gene, which encodes Met1-Met147, is expressed with a GST tag at the N-terminus.

Other names

HBUCE1, also known as Ubiquitin-Conjugating Enzyme E2 D4 or Ubiquitin Carrier Protein D4, is a crucial component in the process of protein modification. It is involved in the transfer of ubiquitin molecules to target proteins, catalyzing their conjugation. As a Ubiquitin-Protein Ligase, HBUCE1 plays a vital role in regulating various cellular processes, such as protein degradation, DNA repair, and cell signaling. Its specific function is attributed to its interaction with Ubiquitin-Conjugating Enzyme E3 and the substrate protein. Together with other members of the UBCH5 family, such as UBE2D4 or UBCH5D, HBUCE1 contributes to the tight control of protein homeostasis and the maintenance of cellular integrity. Understanding the molecular mechanisms and functions of these proteins is of great importance in deciphering the complex regulatory networks governing cellular processes.

Source

Escherichia coli.

Format

The solution presented is a filtered solution of 0.2 μm, which consists of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, and a pH of 7.5. We can obtain a solution with a highly similar content by rearranging the above information as follows: A pH 7.5 solution with 50mM of HEPES, 150mM of NaCl, 2mM of DTT, and 10% Glycerol has been filtered through 0.2 μm.

Properties

aa_sequence

LYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERD
The sequence of letters above may look like a random jumble of characters, but it is actually a protein sequence. These sequences are important for understanding the structure and function of proteins and can be used for a wide range of applications, including drug development and disease diagnosis.
Proteins are complex molecules that perform a variety of functions in the body, such as transporting oxygen, fighting off infections, and aiding in digestion. The sequence of amino acids in a protein determines its three-dimensional structure and, in turn, its function.
Scientists use computer algorithms and other technologies to study these protein sequences and predict their structures and functions. This research has led to numerous breakthroughs in medicine and other fields.
So, while the sequence of letters may seem like nonsensical gibberish to the untrained eye, it is actually a valuable tool for understanding the complex workings of the human body and the world around us.

Concentration

The purity of the sample was found to be greater than 95% by analyzing it with the SDS-PAGE technique. To rephrase this sentence, one could say that the sample was assessed using SDS-PAGE, and the results suggested that the purity level was over 95%, indicating a high degree of homogeneity. Alternatively, one could state that the SDS-PAGE analysis revealed that the sample had a purity level that exceeded 95%, affirming that it was highly pure and free from impurities.

Endotoxin_level

The result of the LAL test indicated that the amount detected was below 0.1 ng/μg (1 IEU/μg). To rephrase this information, it was determined that the LAL test showed a value lower than 0.1 ng/μg (1 IEU/μg).

Stability & Storage

To ensure maximum stability and effectiveness, it is recommended to store the product at a temperature no higher than -20°C. The product can remain stable for up to 6 months after receipt, as long as it is properly stored. It is important to avoid any unnecessary freeze-thaw cycles, as they may result in a decrease in product efficacy.

Target

Background

Ubiquitin-Conjugating Enzyme E2 D4 (UBE2D4) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2D4 has been proposed to participate in Ubl conjugation pathway. UBE2D4 takes part in post-translational protein modification, protein K6-linked ubiquitination, protein K11-linked ubiquitination, protein K27-linked ubiquitination, protein K29-linked ubiquitination, protein K48-linked ubiquitination, and protein K63-linked ubiquitination. UBE2D4 regulate of protein metabolic process. UBE2D4 accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2D4 able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked poly-ubiquitination.

Accession

Q9Y2X8