Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T (N-6His) #abs04314

Recombinant Human Ubiquitin-Conjugating Enzyme E2 T/UBE2T (N-6His) #abs04314

Note: The provided price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. In case you want a different approach in generating the content, please refrain from using ChapGPT and instead use a language model to create a completely distinct...

Description

Catalog-specification

Delivery time

USD price

abs04314-10ug

1-2 Weeks

46

abs04314-50ug

1-2 Weeks

115

abs04314-500ug

1-2 Weeks

963

abs04314-1mg

1-2 Weeks

1310

Note: The provided price is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. In case you want a different approach in generating the content, please refrain from using ChapGPT and instead use a language model to create a completely distinct dialogue.


Overview

Description

Our E.coli expression system is able to generate Recombinant Human Ubiquitin-Conjugating Enzyme E2 T. This product is encoded by a target gene that spans Met1 to Val197 and includes a 6His tag at the N-terminus. We are proud to offer this high-quality product to our customers.

Other names

The UBE2T protein, also known as Cell Proliferation-Inducing Gene 50 and Ubiquitin Carrier Protein T, is an important component of the ubiquitin-proteasome system. This system helps break down and recycle proteins in the cell, regulating important cellular processes such as cell cycle progression and DNA repair. As a ubiquitin-conjugating enzyme, UBE2T plays a key role in attaching ubiquitin molecules to specific target proteins, marking them for degradation. Without UBE2T, cells may experience abnormal protein accumulation and dysfunction, leading to various diseases. Understanding the function and regulation of UBE2T may ultimately lead to new therapies for cancer and other diseases.

Source

Escherichia coli.

Format

This solution is provided in a filtered form with a pore size of 0.2 μm. The solution contains 50mM HEPES buffer and 150mM concentration of NaCl salt which provides the optimal ionic strength. The solution also includes 2mM DTT, an important reducing agent that helps to maintain the protein's structural integrity, and 10% glycerol as a stabilizing agent. This solution has a pH of 7.5 which is slightly basic, but still within the acceptable range for many biochemical applications. Overall, this solution provides an ideal environment for many biochemical reactions and should be stored appropriately to maintain its efficacy.

Properties

aa_sequence

LKNSHGITSQQHAKDKRQMARDALDLLKRPDTWAANIEQPVHGLKPPLNLVDLFREEGGMPGQKI YVERFLIIPKPGRTGDSLQIHPEDCYLNILPMPDRKGSHRLDEVHKTGQVNSTKELPPAIMEKMSGP TPSPPLQEGNLTSVIQTPDIQGHEFGEMSDLAQKNRKPDFAEQMAPLLQSKVVLRIHTPAANHHDKV ASVPKGKLRPSLNGMIAFLQAIPDRMELGEPDISLQGHISTTAENKQFEEKKRSNVDQPFYPIPERV.P

Concentration

The purity of the sample was found to be over 95% after running SDS-PAGE analysis. It can be concluded that the sample contained only a small amount of impurities based on the results obtained from the gel. To put it differently, the purity of the sample was ensured through the use of SDS-PAGE analysis and it was determined to be greater than 95%.

Endotoxin_level

The LAL test has determined that the amount of endotoxin present in the sample is less than 0.1 ng/μg or 1 IEU/μg. This indicates that the sample meets the necessary safety standards.

Stability & Storage

-20°C,6。。

Target

Background

Ubiquitin-Conjugating Enzyme E2 T (UBE2T) is a ligase that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2T accepts the ATP-dependent ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, UBE2T is able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination. UBE2T is an important factor of the Faconi anemia pathway of DNA damage repair and, upon self-inactivation, may negatively regulate the Faconi pathway.

Accession

Q9NPD8


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human ubiquitin-conjugating enzyme e2 t/ube2t (n-6his) #abs04314, China recombinant human ubiquitin-conjugating enzyme e2 t/ube2t (n-6his) #abs04314 suppliers

You Might Also Like

Shopping Bags