Recombinant Human Uteroglobin-Related Protein 1/UGRP1 #abs04315

Recombinant Human Uteroglobin-Related Protein 1/UGRP1 #abs04315

Please note that the price mentioned above is provided as a reference only. For detailed pricing information, please get in touch with our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.

Description

Catalog-specification

Delivery time

USD price

abs04315-10ug

1-2 Weeks

161

abs04315-50ug

1-2 Weeks

482

abs04315-500ug

1-2 Weeks

2353

abs04315-1mg

1-2 Weeks

3201

Please note that the price mentioned above is provided as a reference only. For detailed pricing information, please get in touch with our seller, Vecent.


Overview

Description

Our E.coli expression system is capable of producing Recombinant Human Uteroglobin-Related Protein 1, with the expressed target gene encoding Phe22-Val93. Let's rearrange the content to maintain its original meaning while presenting it differently:
The expression of the target gene encoding Phe22-Val93 in our E.coli expression system leads to the production of Recombinant Human Uteroglobin-Related Protein 1.

Other names

UGRP1, also known as Pneumo Secretory Protein 1 or PnSP-1, belongs to the Secretoglobin Family 3A Member 2. This protein is highly expressed in the lung and is involved in the regulation of inflammation and immune responses. UGRP1 has also been implicated in the development and progression of various respiratory diseases, making it a potential target for therapeutic interventions. Its interaction with other proteins and signaling pathways is still being studied to fully understand its biological functions.

Source

Escherichia coli.

Format

The solution containing 20mM PB and 150mM NaCl, with a pH of 7.4, was subjected to lyophilization after being filtered through a 0.2 μm membrane.

Properties

aa_sequence

VLPEALSHLVKTLGISVEHLDKLAPLVPLPLDNILPFMDPLGPEASEAVKKLLFLINKVEGLRKCVNE 。,。,,。

Concentration

The determination of greater than 95% purity through SDS-PAGE reduction demonstrates the high level of quality achieved.

Endotoxin_level

The result obtained from the LAL test indicates that the measurement is less than 0.1 ng/μg (1 IEU/μg). Let me generate a reformulated text based on the given information: The LAL test determined that the amount is below the threshold of 0.1 ng/μg (equivalent to 1 IEU/μg).

Reconstitution

It is important to always centrifuge tubes containing lyophilized protein before opening to ensure consistent results. Avoid mixing the protein solution by vortex or pipetting as this can cause unwanted aggregation and denaturation. To maintain the stability of the protein, it is recommended to reconstitute it to a concentration no lower than 100 μg/ml. The protein should be dissolved in ddH2O, and it is recommended to aliquot the reconstituted solution to minimize freeze-thaw cycles. Following these guidelines can help ensure that the protein remains stable and active for downstream applications.

Stability & Storage

Proper storage is crucial for lyophilized protein to maintain its stability and integrity. It is recommended to store it at a temperature below -20°C, as this will ensure its long-term viability. However, it's worth noting that it can still remain stable for up to three weeks at room temperature.
Once reconstituted, the protein should be kept in a refrigerated environment between 4-7°C and can last between 2-7 days. If you need to extend the storage period, it's best to divide the solution into small aliquots and freeze them below -20°C. These aliquots can often keep the protein stable for approximately three months.
In short, be mindful of temperature fluctuations when handling and storing lyophilized protein. With proper care and attention, it can remain stable for extended periods, maintaining its biological activity.

Target

Background

Uteroglobin-Related Protein 1 (UGRP1) belongs to the secretoglobin family which has been suggested to play a role in lung inflammation and allergic diseases. UGRP1 is a 17 kDa secreted homodimeric protein that shows amino acid sequence similarity with uteroglobin. UGRP1 is expressed predominantly in the lung and low levels of expression are detected in the thyroid. Expression of UGRP1 in lung epithelial cells is enhanced by IL-10 and decreased through the activities of IL-9 and IL-5. UGRP1 interacts with the macrophage scavenger receptor with collagenous structure which is expressed by alveolar macrophages in the lung. It have suggested that UGRP1 may be involved in inflammation and pathogen clearance in the lung by binding to its receptor.

Accession

Q96PL1


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human uteroglobin-related protein 1/ugrp1 #abs04315, China recombinant human uteroglobin-related protein 1/ugrp1 #abs04315 suppliers

You Might Also Like

Shopping Bags