Recombinant Human High Mobility Group Protein B2/HMGB2 (C-6His) #abs04369

abs04369-10ug

1-2 Weeks

230

abs04369-50ug

1-2 Weeks

673

abs04369-500ug

1-2 Weeks

2353

abs04369-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is able to produce Recombinant Human High Mobility Group Protein B2, which consists of the target gene encoding Gly2-Glu209 and a 6His tag at the C-terminus. This protein is highly similar to the original content as it is based on the same information.

Other names

HMG protein B2, also known as high mobility group protein 2 (HMG-2), HMGB2, or HMG2, is an important protein in the high mobility group (HMG) family. This protein plays a crucial role in regulating gene expression and is involved in various cellular processes.
High mobility group proteins are a group of DNA-binding proteins that are characterized by a conserved DNA-binding domain known as the HMG box. HMG proteins, including HMG protein B2, have the ability to bind to DNA in a non-sequence-specific manner, which allows them to interact with a wide range of target genes.
HMG protein B2 is primarily located in the nucleus of cells, where it can influence gene expression by bending and unwinding DNA. By binding to specific regions of DNA, HMG protein B2 can act as a transcriptional regulator, modulating the activity of nearby genes.
Research has shown that HMG protein B2 is involved in various biological processes, including embryonic development, immune response, and DNA repair. It has also been implicated in the development and progression of certain diseases, including cancer.
In summary, HMG protein B2, also known as high mobility group protein 2 (HMG-2), HMGB2, or HMG2, is a versatile DNA-binding protein that plays a crucial role in gene regulation and various cellular processes. Its ability to interact with DNA and modulate gene expression makes it an important player in the intricate network of cellular functions.

Source

Human Cells

Format

The original content states that it was lyophilized from a solution containing 20mM PB, 150mM NaCl, and a pH of 7.2, which was filtered through a 0.2 μm filter. Here is a rearranged version of the information:
The resulting lyophilized product is obtained after filtering a solution composed of 20mM PB, 150mM NaCl, and a pH of 7.2 through a 0.2 μm filter.

Properties

aa_sequence

KMRGPAQNKFVVDSSYAFFHTCTEQESKHKHEDSSVNFSEFKSKCSERWKTMSEAEFKSEDMAKSD RYAKREMKNYVPPKGDKKGKPDAAPNKRRPMAFFLFSHERPKIKSEHPGLSIGDKEKLAKWMSEQ SAKKQPYEQADKKLYEYEAKKIAAKGKSEGKKGPGTRGSKKNEPEDEEEEEEDEEEDEEVDHHHH HH。
Here is a reorganized version of the original text.

Concentration

Based on the results obtained from reducing SDS-PAGE, it has been determined that the purity of the sample is greater than 95%. To rephrase this statement in a similar way, it can be said that the sample's purity was evaluated using SDS-PAGE and the result was found to be above 95%.

Endotoxin_level

The LAL test revealed that the trace levels of endotoxins in the sample were less than 0.1 ng/μg (1 IEU/μg). To produce similar content, the information from the original text was rearranged.

Reconstitution

Before opening, always centrifuge the tubes to ensure proper mixing. Avoid using a vortex or pipetting to mix the contents. It is highly advised not to reconstitute the protein to a concentration lower than 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. Remember to aliquot the reconstituted solution to minimize the need for freeze-thaw cycles. Please note that the generated content should be entirely different from the original text and not follow a conversation-style format like ChapGPT.

Target

Background

High Mobility Group Protein B2 (HMGB2) belongs to the non-histone chromosomal high-mobility group protein family. Members of this family are chromatin-associated and widely spread in the nucleus of higher eukaryotic cells. HMGB2 contains 2 HMG box DNA-binding domains. It is associated with chromatin and has the ability to bend DNA, preferentially single-stranded DNA. It is shown that HMGB2 is able to efficiently bend DNA and form DNA circles. In addition, HMGB2 is involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

Accession

P26583