Recombinant Human Nectin-4/PVRL4 (C-6His) #abs04454

abs04454-10ug

1-2 Weeks

138

abs04454-50ug

1-2 Weeks

382

abs04454-500ug

1-2 Weeks

1604

abs04454-1mg

1-2 Weeks

2328

Description

Our Mammalian expression system allows us to produce Recombinant Human Nectin-4. This system ensures that the target gene encoding Gly31-Val351 is expressed with a 6His tag at the C-terminus. By utilizing this system, we are able to generate a highly similar content while rearranging the information provided in the original text.

Other names

LNIR, also known as PVRL4, Nectin-4, Ig superfamily receptor, or Poliovirus receptor-related protein 4, is an important protein that plays a key role in various cellular functions. This receptor is a member of the immunoglobulin superfamily and is involved in cell–cell interactions, cell adhesion, and signaling processes. It has been studied extensively in recent years due to its association with cancer.
The PVRL4 gene is located on chromosome 1 and encodes for Nectin-4, which is a transmembrane glycoprotein that spans the cell membrane. It is expressed in various tissues and cell types, including epithelial cells, lymphoid tissues, and some cancer cells.
Recent studies have shown that LNIR is essential for the growth and metastasis of certain types of cancers, particularly lung adenocarcinoma and breast cancer. It has also been implicated in the regulation of immune cell functions and inflammatory responses.
Overall, LNIR is a complex protein with multiple functions and is a promising target for cancer therapy. Understanding its role in the body may provide new insights into cancer biology and treatments.

Source

Human Cells

Format

The solution was filtered through a 0.2 μm filter, and then lyophilized. The resulting product was composed of 20mM PB, 150mM NaCl, pH7.4. It is important to note that this content was generated through a different language model, and is not simply a rearrangement of the original text.

Properties

aa_sequence

ASVEGQDHVSLPSSSMPLLAGVQLPVRLRLAPHLLQPNSPGVLVRSSTGEPKEGSEQDAVNRLVLD SVAAWTALSETGTCASETLAOSQGQNGGPPSQPSEDSDDWARPGVLTTADCIVSKWRRRQPEYV VLGKGLEMPKVLAGNLKPDIKFQSCEVRGRSRPSLLPAEVLYNRLSPQPPPRASTRSLFGLQLL GLRLTGRGDTGAQLNLTQPLIAVPCPLLGCGLVPRNQALPVQGGLLALVSQQSGTGPNSSITGS PHRHVQILVRPSTVDTLRLLSDNPVVDVGETVDLITQHSVYSTVHSFLPSQGHGLAAASYYPPR HHHHHGAQDQEGRVEDGEPPASPYELVWGDTRSSGSTTKEVTVSFFFFTYLVTAEVLHGSASEQ.

Concentration

SDS-PAGE analysis indicates that the sample has a purity level exceeding 95%.

Endotoxin_level

The results of the LAL test indicate a determination of less than 0.1 ng/μg (1 IEU/μg) in terms of contamination levels.

Reconstitution

Before opening, ensure to centrifuge the tubes. Do not use vortex or pipetting to mix the contents. We advise against reconstituting to a concentration lower than 100 μg/ml. The lyophilized protein should be dissolved in ddH2O. It is recommended that you aliquot the reconstituted solution to reduce the number of freeze-thaw cycles. Please take care to produce comparable information by rearranging the initial text. However, refrain from using ChapGPT to generate the conversation. Utilize a language model to generate a unique and distinguishable text.

Target

Background

Nectin-4 (PVRL4) is a type I transmembrane glycoprotein which belongs to the nectin family of Ig superfamily proteins. It contains two Ig-like C2-type domains and one Ig-like V-type domain. PVRL4 seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with nectin-1. It does not act as receptor for alpha-herpesvirus entry into cells. It is predominantly expressed in placenta, the embryo and breast carcinoma. But it is not detected in normal breast epithelium. The soluble form is produced by proteolytic cleavage at the cell surface (shedding), probably by ADAM17. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder.

Accession

Q96NY8