Recombinant Human Retinoic Acid Receptor Responder Protein 2/Chemerin/TIG2 (C-6His) #abs04455

abs04455-10ug

1-2 Weeks

161

abs04455-50ug

1-2 Weeks

482

abs04455-500ug

1-2 Weeks

2353

abs04455-1mg

1-2 Weeks

3201

Description

Our Mammalian expression system is used to produce Recombinant Human Chemerin. The target gene, which encodes Glu21-Ser157, is expressed with a 6His tag at the C-terminus.

Other names

Chemerin is a protein known as retinoic acid receptor responder protein 2 or Tazarotene-induced gene 2 protein. It is also referred to as RAR-responsive protein TIG2 or RARRES2. This multifunctional protein plays a significant role in various biological processes. Its unique properties make it an essential component in cellular responses to retinoic acid and other ligands. The presence of Chemerin in different tissues and its involvement in various signaling pathways contribute to its diverse functionalities. Understanding the mechanisms of Chemerin action opens up new avenues for therapeutic interventions in different diseases and disorders. Its complexity and versatility make it an intriguing subject of study in the field of molecular biology.

Source

Human Cells

Format

The lyophilization process involves drying a solution that has been filtered through a 0.2 μm filter. The original solution was prepared using 20mM PB and 150mM NaCl at a pH of 7.4. By removing the water through freeze-drying, the resulting lyophilized product retains the composition of the initial solution.

Properties

aa_sequence

AFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPQWAFQETSVESAVDTPFELTEAQRRGLQVALEEFHKHPPVQWIFVRLEFKLQQTSCRKRDWKKPPGQFAFSVDHHHHHHRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFCIKLGSEDKVLGRLVBQETSVESAVDTPFELTEAQRRGLQVALEEFHKHPPVQWA，ECKVRPNGRKRKCLA

Concentration

The protein purity was found to be over 95% using SDS-PAGE analysis. To rephrase this information, it can be stated that the protein sample exhibited a purity of more than 95% based on the results obtained from the SDS-PAGE reduction method.

Endotoxin_level

The LAL test determines that the content is less than 0.1 ng/μg (1 IEU/μg). Let's rearrange the information to generate highly similar content: The content, as determined by the LAL test, is found to be 1 IEU/μg, which is less than 0.1 ng/μg.

Reconstitution

Before opening, always centrifuge tubes. Avoid mixing by vortex or pipetting. It is advisable not to dissolve to a concentration lower than 100 μg/ml. Rehydrate the lyophilized protein using ddH2O. Remember to aliquot the reconstituted solution to minimize the number of freeze-thaw cycles.

Target

Background

Retinoic acid receptor responder protein 2 (RARRES2) is a secreted protein that in humans is encoded by the RARRES2 gene. It is highly expressed in skin, also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon. It is a chemoattractant protein that acts as a ligand for the G protein-coupled receptor CMKLR1. RARRES2 is secreted in an inactive form as prochemerin and is activated through cleavage of the C-terminus by inflammatory and coagulation serine proteases. It is thought to act as a cell surface receptor, found to stimulate chemotaxis of dendritic cells and macrophages to the site of inflammation. RARRES2 is inhibited in psoriatic lesions, it is activated by tazarotene in skin rafts and in the epidermis of psoriatic lesions.

Accession

Q99969