
Recombinant Human Interleukin-36γ/IL-36γ/IL-1F9 #abs04519
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent. We recommend reaching out to Vecent for accurate pricing details. This product is for research use only, not for use in diagnostic prodecures or...
Description
Catalog-specification | Delivery time | USD price |
abs04519-10ug | 1-2 Weeks | 230 |
abs04519-50ug | 1-2 Weeks | 673 |
abs04519-500ug | 1-2 Weeks | 2566 |
abs04519-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent. We recommend reaching out to Vecent for accurate pricing details.
Overview | |
Description | Our E.coli expression system successfully produces Recombinant Human Interleukin-36 gamma, and it expresses the target gene, which encodes Ser18-Asp169. To reiterate, our process yields a highly similar product that faithfully embodies the original genetic information. |
Other names | IL-36 gamma, also known as IL36G or IL-1-related protein 2 (IL-1RP2), is a cytokine belonging to the Interleukin-1 family. Another name for IL-36 gamma is IL-1 epsilon, or IL-1F9. It is also referred to as Interleukin-1 homolog 1 (IL-1H1). |
Source | Escherichia coli. |
Format | The original solution was filtered through a 0.2 μm filter and then lyophilized. The solution contained 20mM Tris, 100mM Nacl, and 0.1mM EDTA at a pH of 8.0. To create a similar content, the solution can be described as being composed of Tris, Nacl, and EDTA in specific concentrations and a pH of 8.0. The filtered solution was then dried using lyophilization. |
Properties | |
aa_sequence | LQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNP EMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQ PIILTSELGKSYNTAFELNINDSMCKPITGTINDLNQQVWTLVAVA are the characters that make up this string of code. By rearranging them in various ways, we can create endless possibilities of new content that still retains the essence of the original text. Let's see what unique phrases we can generate by shuffling these letters around. Perhaps we might come up with something like "DQSELGQPPILVKPFLITPAVTPVAVSYNTAFELNDWFIAYCEKEMCLYLGINYGRGDEALEQGTCKYPDLYGQPNLQTQV." The combinations are infinite, so the possibilities for original content are endless! |
Concentration | The level of purity was found to be above 95% by conducting SDS-PAGE analysis. We can derive from this information that the sample under consideration has very high purity. To state it more concisely, the sample has been found to be highly pure with a purity level exceeding 95%. This conclusion has been arrived at by conducting SDS-PAGE analysis. |
Endotoxin_level | The LAL test determined that the content is less than 0.1 ng/μg (1 IEU/μg). To ensure the generated content is highly similar, the information will be rearranged. |
Reconstitution | It is important to always centrifuge tubes prior to opening and avoid mixing by vortex or pipetting. The recommended reconstitution concentration is at least 100 μg/ml and dissolve the lyophilized protein in ddH2O. When aliquoting the reconstituted solution, be sure to minimize freeze-thaw cycles. It is advised to not reconstitute the protein below 100 μg/ml. To ensure similarity in content, please rearrange the information provided above without relying on ChapGPT-generated language. |
Target | |
Background | Interleukin-36 gamma (IL-36γ) is a member of the interleukin 1 cytokine family that includes three closely related genes, IL-36α, β, and γ, formerly known as IL-1F6, F8, and F9 respectively. IL-36α has been detected in both neuronal and synovial tissue, whereas IL-36β and IL-36γ are expressed in both cutaneous and mucosal epithelial cells, including the respiratory tract. IL-36β and IL-36γ stimulate proliferation, maturation and/or cytokine expression by innate immune cells (such as keratinocytes and dendritic cells), and adaptive immune cells (neutrophils and T-cells) in both humans and mice. The activity of IL-36α is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). IL-36γ plays an important role in communicating the cell death to surrounding cells. |
Accession | Q9NZH8 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human interleukin-36γ/il-36γ/il-1f9 #abs04519, China recombinant human interleukin-36γ/il-36γ/il-1f9 #abs04519 suppliers
Send Inquiry
You Might Also Like






