
Recombinant Human Serotransferrin/Transferrin (C-6His) #abs04456
Please note that the price mentioned above is only for your reference. To obtain detailed pricing information, please get in touch with our seller, Vecent. It is important to understand that the price may vary depending on the specific requirements of your order. Therefore, we highly recommend...
Description
Catalog-specification | Delivery time | USD price |
abs04456-10ug | 1-2 Weeks | 77 |
abs04456-50ug | 1-2 Weeks | 230 |
abs04456-500ug | 1-2 Weeks | 1146 |
abs04456-1mg | 1-2 Weeks | 1528 |
Please note that the price mentioned above is only for your reference. To obtain detailed pricing information, please get in touch with our seller, Vecent. It is important to understand that the price may vary depending on the specific requirements of your order. Therefore, we highly recommend contacting our seller to obtain accurate pricing information.
Overview | |
Description | Our Mammalian expression system produces Recombinant Human Transferrin with a 6His tag at the C-terminus. The target gene, Val20-Pro698, is expressed to ensure high-quality protein production. Our process results in a product that closely mimics the natural human transferrin protein, making it an ideal choice for research and development applications. |
Other names | Transferrin, also known as serotransferrin, is a metal-binding globulin. It is also referred to as siderophilin or TF. |
Source | Human Cells |
Format | The solution of PBS with a pH of 7.4 was filtered through a 0.2 μm filter and subsequently lyophilized. Let me generate a content with a highly similar meaning, but with a different arrangement of the information: The pH 7.4 PBS solution was first filtered using a 0.2 μm filter, and then it was lyophilized to obtain the final product. |
Properties | |
aa_sequence | LDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVG RTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGA FRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNH AVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKY LGEEYVKAVGNLRKCSTSSLLEACTFRRPVDHHHHHHVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAG LVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNI PIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCL KDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKE DLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRN LREGTCPEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMS |
Concentration | SDS-PAGE95%。,。 |
Endotoxin_level | The LAL test confirms that the concentration of less than 0.1 ng/μg (1 International Endotoxin Unit per microgram) meets the specified requirement. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Serotransferrin belongs to transferrin family, and contains 2 transferrin-like domains. The protein is a secreted protein, and expressed by the liver and secreted in plasma. Transferrins are iron binding transport proteins which can bind two Fe3+ ions in association with the binding of an anion. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation. |
Accession | P02787 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human serotransferrin/transferrin (c-6his) #abs04456, China recombinant human serotransferrin/transferrin (c-6his) #abs04456 suppliers
Send Inquiry
You Might Also Like






