
Recombinant Mouse IL-15 Receptor Subunit α/CD215/IL-15RA (C-Fc) #abs04459
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to note that the content generated using language models should be significantly different from the original text and should not...
Description
Catalog-specification | Delivery time | USD price |
abs04459-10ug | 1-2 Weeks | 77 |
abs04459-50ug | 1-2 Weeks | 161 |
abs04459-500ug | 1-2 Weeks | 993 |
abs04459-1mg | 1-2 Weeks | 1528 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, kindly get in touch with our seller Vecent. It is important to note that the content generated using language models should be significantly different from the original text and should not follow the style of ChapGPT-generated content.
Overview | |
Description | Our Mammalian expression system produces Recombinant Mouse Interleukin-15 receptor alpha. The target gene, which encodes Gly33-Lys205, is expressed with an Fc tag at the C-terminus. |
Other names | The alpha subunit of the interleukin-15 receptor, known as Il15ra, plays a crucial role in immune responses. The soluble form of this subunit, sIL-15 receptor subunit alpha, is generated when the transmembrane domain is cleaved off. Both forms of the receptor subunit bind to interleukin-15, a cytokine involved in various aspects of immune cell development and function. Understanding the functions and regulation of Il15ra and sIL-15 receptor subunit alpha is important for developing new therapies for immune disorders. |
Source | Human Cells |
Format | The solution was filtered through a 0.2 μm filter and then lyophilized. The filtered solution consisted of 20mM PB, 150mM NaCl, with a pH of 7.4. |
Properties | |
aa_sequence | ARNISKDPTVHTTSWVIECVSVYSNNRVKACFSGKKGTRLSKINTVNAKCIHLWCPTSPSLAKY RSAPDLPTTVPSEPPSQAKSPFETSMTADEKSPAFSPQVSTETATMLPGKTSRSQTPATGTTG TSHKRASLATEMTLPTASTISSRPKEVMKTVDMGIEKDCSTTCPAKPECLPLSGEPSVGLFPP VKPKDTLMISRTTCEVVPVVDVEHETEKFNWYVDGEVHMVKTIYREKYNSTPRVSVTVLHLQDW LSGKETYKCKVSNAKAPIEKTIPKAKGQPREPKVETMSQREEMNLKNTVCVGFPYADIWESGQ PENNTYKTPSLVVPDSDGFFLYSKLRWVDKSQVNFGCSMHAELHNYTSKSLSLPGKTT. |
Concentration | Reducing SDS-PAGE is used to determine the protein concentration and purity of a sample. By analyzing the gel, we can accurately assess if the protein of interest is present at a concentration greater than 95%. |
Endotoxin_level | The LAL test has determined the presence of less than 0.1 ng/μg (1 IEU/μg) in the sample. |
Activity | The potency of this substance can be evaluated by its ability to obstruct the human IL-15-induced proliferation of mouse cytotoxic T cells (CTLL-2). The threshold for this activity typically lies at 1.95 ng/mL. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, or gamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with the mouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting from alternative splicing events involving different exons. |
Accession | Q60819 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse il-15 receptor subunit α/cd215/il-15ra (c-fc) #abs04459, China recombinant mouse il-15 receptor subunit α/cd215/il-15ra (c-fc) #abs04459 suppliers
Send Inquiry
You Might Also Like






