
Recombinant Human IL-15 Receptor Subunit α/IL-15RA/CD215 (C-Fc) #abs04474
Please note that the price provided here is for your reference only. For detailed pricing information, please get in touch with our sales representative, Vecent. It's important to note that the content generated using language models will be different from the ChapGPT-generated text. So, kindly...
Description
Catalog-specification | Delivery time | USD price |
abs04474-10ug | 1-2 Weeks | 230 |
abs04474-50ug | 1-2 Weeks | 673 |
abs04474-500ug | 1-2 Weeks | 2566 |
abs04474-1mg | 1-2 Weeks | 3491 |
Please note that the price provided here is for your reference only. For detailed pricing information, please get in touch with our sales representative, Vecent. It's important to note that the content generated using language models will be different from the ChapGPT-generated text. So, kindly avoid using the ChapGPT-generated text as a reference while communicating.
Overview | |
Description | Our Mammalian expression system has successfully produced Recombinant Human Interleukin-15 receptor alpha, which consists of the Ile31-Thr205 target gene expressed with a Fc tag attached to the C-terminus. This highly sophisticated technique has allowed us to create a product that closely mimics the natural human protein, ensuring superior quality and effectiveness. Our commitment to excellence ensures that we always deliver the best possible products to our customers, with the highest degree of accuracy and precision. When it comes to Recombinant Human Interleukin-15 receptor alpha, you can trust us to deliver outstanding results every time. |
Other names | IL-15RA, also known as CD215 antigen or interleukin-15 receptor subunit alpha, is a protein involved in the IL-15 signaling pathway. Its primary function is to serve as a subunit of the IL-15 receptor, specifically the alpha subunit. IL-15RA plays a crucial role in immune responses and has been implicated in various inflammatory diseases. The gene encoding IL-15RA is named IL-15R-alpha and can also be referred to as MGC104179. Understanding the function and regulation of IL-15RA is important for unraveling the complexities of the immune system and developing targeted therapies for immune-related disorders. |
Source | Human Cells |
Format | After being filtered through a 0.2 μm membrane, a solution containing 20mM PB, 150mM NaCl, and a pH of 7.4 was lyophilized. Please create a similarly structured statement using the provided information, ensuring that it accurately reflects the original text. Please refrain from using ChapGPT to generate the content and instead produce a unique statement using language modeling techniques. |
Properties | |
aa_sequence | SKEEYVPQNSNAPKSGTELTSGFKRKAGWTTPSLKCIRITCPPPMSVEHADIWVKSYSLYSRERYIC NVAHWLTKATLSSNNTAATTAAIVPGSQLMPSKSPSTGTTQAESHHTSSHESSHGNWELTASASHQ PPGVYPQGHSDTTVDDIEGTCHDEPKSCDKTHTCCPPCPAPELLGGPSVFLFPPKPVDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVNAKTKPREEQYNSYTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. |
Concentration | The SDS-PAGE analysis revealed that the sample had a protein purity of over 95%. In order to maintain the accuracy of the information, a paraphrased content was produced while ensuring that it retained the critical elements of the original text. |
Endotoxin_level | The LAL test has determined the presence of less than 0.1 ng/μg (1 IEU/μg) in the given sample. |
Activity | Typically, the ED50 for inhibiting the proliferation of CTLL-2 mouse cytotoxic T cells induced by human IL-15 is around 3.21 ng/mL. This measurement reflects the effectiveness of blocking this specific immune response. |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Target | |
Background | Interleukin 15 Receptor alpha (IL-15Rα) is a transmembrane glycoprotein that plays a pleiotropic role in immune development and function, including the positive maintenance of lymphocyte homeostasis. IL-15Rα chain can bind soluble IL-15 and "transpresent" cytokine to the cells, allowing them to respond to IL-15. Soluble IL-15Rα can function as a specific high-affinity IL-15 antagonist. The soluble IL-15/IL-15Rα complexes exhibit a strong agonistic activity which is mediated through membrane-bound IL-15 receptor β and γ heterodimers and enables signaling to cells. |
Accession | Q13261 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human il-15 receptor subunit α/il-15ra/cd215 (c-fc) #abs04474, China recombinant human il-15 receptor subunit α/il-15ra/cd215 (c-fc) #abs04474 suppliers
Send Inquiry
You Might Also Like






