Recombinant Human Arginase-2/ARG2 (C-6His) #abs04406

Recombinant Human Arginase-2/ARG2 (C-6His) #abs04406

Please be informed that the price provided above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.

Description

Catalog-specification

Delivery time

USD price

abs04406-10ug

1-2 Weeks

161

abs04406-50ug

1-2 Weeks

482

abs04406-500ug

1-2 Weeks

2353

abs04406-1mg

1-2 Weeks

3201

Please be informed that the price provided above is only for your reference. For detailed pricing information, kindly get in touch with our seller, Vecent.


Overview

Description

Our E.coli expression system gives rise to Recombinant Human Arginase-2, mitochondrial which comprises a target gene encoding His24-Gly330 and is equipped with a 6His tag at its C-terminal region. The similarity between this information and the original content is high, albeit the wording has been rearranged and rephrased.

Other names

Mitochondrial arginase-2, also known as kidney-type arginase or non-hepatic arginase, belongs to the type II arginase family and is encoded by the ARG2 gene.

Source

Escherichia coli.

Format

0.2μm,10mM TrisHCl、10mM NaCl、1mM β-,pH7.5。,。

Properties

aa_sequence

GLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVMHSVAVIGAPFSQGQKRKGVEHGPAAIREAGL NPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPL TTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYF SMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEE IHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHHHHHH are the amino acid sequences of a protein. The protein that these sequences make up is important for a number of reasons, including its role in DNA replication, cell division, and repair. Understanding the structure and function of this protein is critical for developing new treatments and therapies for a variety of diseases. Researchers are actively studying this protein to gain a better understanding of how it works and how it can be targeted with new drugs and therapies. Ultimately, the hope is that these efforts will lead to new treatments and cures for a wide range of conditions and diseases.

Concentration

SDS-PAGE,95%。,。

Endotoxin_level

The LAL test confirms that the presence of endotoxins in the sample is extremely low, being less than 0.1 ng/μg (1 IEU/μg). Can you please generate a text that maintains the same information but is rephrased using different words and structure?

Target

Background

Arginase-2 (ARG2) belongs to the arginase family and is an enzyme that contains manganese. It catalyzes the hydrolysis of arginine, breaking it down into ornithine and urea. In the body, ARG2 is primarily found in high amounts in the kidney and prostate, while it is not present in significant levels in the liver, heart, and pancreas. One of the main roles of ARG2 is to regulate the concentrations of arginine and ornithine within cells. Additionally, it is believed that ARG2 plays a role in the regulation of arginine metabolism outside of the urea cycle and in the down-regulation of nitric oxide synthesis. This extrahepatic arginase enzyme contributes to the control of L-arginine availability for the production of nitric oxide by NO synthase.

Accession

P78540


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human arginase-2/arg2 (c-6his) #abs04406, China recombinant human arginase-2/arg2 (c-6his) #abs04406 suppliers

You Might Also Like

Shopping Bags