
Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2/UBE2J2 (N-GST) #abs04405
Please note that the price provided is only for your reference. For detailed pricing information, we recommend contacting our sales representative, Vecent. It is important to get in touch with our team to ensure that you receive accurate pricing information tailored to your specific needs. So,...
Description
Catalog-specification | Delivery time | USD price |
abs04405-10ug | 1-2 Weeks | 230 |
abs04405-50ug | 1-2 Weeks | 673 |
abs04405-500ug | 1-2 Weeks | 2353 |
abs04405-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is only for your reference. For detailed pricing information, we recommend contacting our sales representative, Vecent. It is important to get in touch with our team to ensure that you receive accurate pricing information tailored to your specific needs. So, please reach out to Vecent for any related queries.
Overview | |
Description | Our E.coli expression system has yielded Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2, which is expressed with a GST tag at the N-terminus. Specifically, the target gene encoding Glu124-Arg224 has been successfully expressed. We are pleased to offer this high-quality product to our customers. |
Other names | The protein Ubiquitin-Conjugating Enzyme E2 J2, also known as Non-Canonical Ubiquitin-Conjugating Enzyme 2 or NCUBE-2, is encoded by the UBE2J2 gene. UBE2J2 plays an important role in protein ubiquitination, a process that regulates protein turnover and cellular signaling. As a ubiquitin-conjugating enzyme, UBE2J2 helps transfer ubiquitin molecules to target proteins, marking them for degradation or other cellular processes. The function of UBE2J2 is not fully understood, but it is believed to be involved in various cellular pathways, including the immune response and viral infection. Research has shown that UBE2J2 may play a role in the development of certain diseases, such as cancers. Thus, understanding the function of UBE2J2 may have implications for therapeutic interventions in the future. |
Source | Escherichia coli. |
Format | The provided solution is a 0.2 μm filtered solution containing 20mM PB, 150mM NaCl, 1mM DTT, and having a pH of 7.2. |
Properties | |
aa_sequence | NGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATF GGGDHPPKSDLVPRGSPEFHMEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEI KQKAKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRMSPI LGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQS MAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKM FEDRLCHKTYL. |
Concentration | Our analysis via SDS-PAGE indicated that the purity of the sample is greater than 95%. To reiterate, the results of our testing showed that the concentration of impurities in the sample is incredibly low, with a confidence level of over 95%. |
Endotoxin_level | The determined LAL test indicates that the concentration is below 0.1 ng/μg (1 IEU/μg). A closely matching content can be created by rearranging the information as follows: The LAL test has confirmed that the level is determined to be less than 0.1 ng/μg (1 IEU/μg). |
Target | |
Background | Ubiquitin-Conjugating Enzyme E2 J2 (UBE2J2) is a member of the ubiquitin-conjugating enzyme family and is primarily located in the endoplasmic reticulum membrane. Its main function is to catalyze the attachment of ubiquitin to various proteins through covalent bonds. This process of ubiquitination is crucial in regulating protein degradation. UBE2J2 specifically plays a significant role in the selective degradation of misfolded membrane proteins within the endoplasmic reticulum. By targeting these faulty proteins, UBE2J2 helps maintain the quality control of protein folding in this cellular compartment. |
Accession | Q8N2K1 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human ubiquitin-conjugating enzyme e2 j2/ube2j2 (n-gst) #abs04405, China recombinant human ubiquitin-conjugating enzyme e2 j2/ube2j2 (n-gst) #abs04405 suppliers
Send Inquiry
You Might Also Like






