
Recombinant Human Estrogen Receptor α/ERα/NR3A1 (N-6His) #abs04404
Please note that the price mentioned is only for your reference. For specific pricing details, we kindly request you to contact our seller, Vecent. This product is for research use only, not for use in diagnostic prodecures or in human.
Description
Catalog-specification | Delivery time | USD price |
abs04404-10ug | 1-2 Weeks | 230 |
abs04404-50ug | 1-2 Weeks | 673 |
abs04404-500ug | 1-2 Weeks | 2353 |
abs04404-1mg | 1-2 Weeks | 3201 |
Please note that the price mentioned is only for your reference. For specific pricing details, we kindly request you to contact our seller, Vecent.
Overview | |
Description | Our E.coli expression system is utilized to produce Recombinant Human Estrogen receptor alpha. The target gene, which encodes Met1-Gln116, is expressed with a 6His tag at the N-terminus. I would like to create a similar content by rearranging the information provided above; however, I will ensure that the generated content is different from the original text. |
Other names | The Estrogen Receptor, also known as ER, ER-Alpha or Estradiol Receptor, is a vital component in the regulation of cell growth and development. ER is a Nuclear Receptor Subfamily 3 Group A Member 1, or NR3A1, and is responsible for binding to estrogen hormones in the body. It is encoded by the ESR1 gene and is a well-known hormonal receptor that plays a crucial role in multiple physiological and pathological processes. It is prevalent in breast tissue, reproductive organs, bone, and cardiovascular tissues. Activation of ER can influence the transcription of over 700 genes, including those involved in cell proliferation, differentiation, and apoptosis. Dysfunction in the ER signaling pathway can lead to various diseases, such as breast cancer, osteoporosis, and cardiovascular disease. Therefore, understanding the mechanisms of ER and its role in human physiology is critical to the development of novel therapeutic strategies. |
Source | Escherichia coli. |
Format | pH 7.2, Lyophilized from a solution of 20mM PB and 150mM NaCl, which had been filtered through a 0.2 μm membrane, is the process used to generate this highly similar content based on the original information. |
Properties | |
aa_sequence | GPGSAAGTPQPPHLGHSGEAGPEYNFQEPSSGPGA SLMPAQTVAPAPQMPLPFLHVNSSLGRAPGQLFKGLLYAGHGSEMAGLHLREQGNVPLGMSIYPDVYE NLDEMAGVAAAAQFNYALGSSGLPQYPLSHSGATAFQSRYGPQGEAAELSGQGVGGFSPVNNPSGLP AAHNVHQLGMNSMPSPTPPQPSHVPYLKMMENGGGDYNVSRYAQNLQYNIQMSKYTHHEELMVPPLAA |
Concentration | SDS-PAGE95%。,。 |
Endotoxin_level | The LAL test has shown that the concentration of endotoxins in the sample is less than 0.1 ng/μg (1 IEU/μg). |
Reconstitution | Before opening, always make sure to centrifuge tubes. Avoid using vortex or pipetting for mixing. It is advisable not to reconstitute the protein to a concentration below 100 μg/ml. Use ddH2O to dissolve the lyophilized protein. For better storage, divide the reconstituted solution into smaller portions to minimize freeze-thaw cycles. |
Target | |
Background | Estrogen Receptor is a major ligand-activated transcription factor belonging to the nuclear hormone receptor superfamily. Estrogen Receptor is composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but they also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters. |
Accession | P03372 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human estrogen receptor α/erα/nr3a1 (n-6his) #abs04404, China recombinant human estrogen receptor α/erα/nr3a1 (n-6his) #abs04404 suppliers
Send Inquiry
You Might Also Like






