
Recombinant Mouse Macrophage Metalloelastase/MMP12 (C-6His) #abs04357
Please note that the price mentioned above is only for your reference. For detailed pricing information, please contact our sales representative, Vecent. It's important to get in touch with Vecent to know the exact cost involved. This product is for research use only, not for use in diagnostic...
Description
Catalog-specification | Delivery time | USD price |
abs04357-10ug | 1-2 Weeks | 230 |
abs04357-50ug | 1-2 Weeks | 673 |
abs04357-500ug | 1-2 Weeks | 2353 |
abs04357-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned above is only for your reference. For detailed pricing information, please contact our sales representative, Vecent. It's important to get in touch with Vecent to know the exact cost involved.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Mouse Matrix Metalloproteinase 12. This system effectively expresses the target gene, which encodes Ala29-Cys473, with a 6His tag at the C-terminus. Please rearrange and utilize the provided information to generate content that closely aligns with the original text. Avoid generating content using the conversational method of ChapGPT. |
Other names | The different names for Macrophage metalloelastase include MME, Matrix metalloproteinase-12, MMP-12, Mmp12, Mme, Mmel. It is essential to note the various aliases and alternate names by which Macrophage metalloelastase is known. These names may be used interchangeably in scientific literature and discussions to refer to the same protein. |
Source | Human Cells |
Format | This solution is provided in PBS with a pH of 7.4 and has been filtered through a 0.2 μm filter. Can you please create a similar statement using the information provided, but rearrange the wording in a different way? It is important that the new statement is based on the original text information and not generated using ChapGPT technology. |
Properties | |
aa_sequence | APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHI PRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHK DEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHE LGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQ SLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKD EKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAY PKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGCVDHHHHHH. |
Concentration | According to the results obtained from SDS-PAGE analysis, the similarity of the sample is greater than 95%. This indicates a very high level of similarity between the sample and the reference material. |
Endotoxin_level | By using the LAL test, it was determined that the amount of endotoxin present is less than 0.1 ng/μg (1 IEU/μg). A highly similar content can be generated by reorganizing the information provided in the original text. |
Target | |
Background | Matrix metalloproteinase-12 (MMP12) is a secreted protein.It contains 4 hemopexin repeats and belongs to the peptidase M10A family. MMP12 may be involved in tissue injury and remodeling and have significant elastolytic activity. It can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3. |
Accession | P34960 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant mouse macrophage metalloelastase/mmp12 (c-6his) #abs04357, China recombinant mouse macrophage metalloelastase/mmp12 (c-6his) #abs04357 suppliers
Send Inquiry
You Might Also Like






