
Recombinant Human Dickkopf-Related Protein 1/DKK1 (N-8His) #abs04355
Please note that the price mentioned is only for your reference. For detailed pricing information, we kindly ask you to contact our seller Vecent. Thank you. As a language model, I am not able to engage in conversations and can only generate text based on the given prompt. This product is for...
Description
Catalog-specification | Delivery time | USD price |
abs04355-10ug | 1-2 Weeks | 230 |
abs04355-50ug | 1-2 Weeks | 673 |
abs04355-500ug | 1-2 Weeks | 2353 |
abs04355-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned is only for your reference. For detailed pricing information, we kindly ask you to contact our seller Vecent. Thank you. As a language model, I am not able to engage in conversations and can only generate text based on the given prompt.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Dickkopf-related protein 1. The target gene that is expressed includes a 8His tag at the N-terminus and encodes Thr32-His266. So, to summarize, our system generates the recombinant protein by expressing the specific target gene along with the required 8His tag. |
Other names | Dickkopf-related protein 1, Dickkopf-1, Dkk-1 |
Source | Human Cells |
Format | The solution of PBS with a pH of 7.4 was filtered through a 0.2 μm filter and then lyophilized to create the final product. |
Properties | |
aa_sequence | NSVYLGGNKYPQYPCTDNYQEEDEECGSPTRGGDAQICLACVQNHFRGEIEEKRCRPAMHSCMGPN YCKNGRHTLSSDGYSSTLDQTIDNVSAAPGPGSAVPPPLNLPPPKNAIKNPPLGGAAGHPGQTL HHHHHHHHSCLACRKRRKRCMRESFGNDASGLCCARRKGQVCTKHRRKGSVLCRCYCGESDCARH FWSKEIGSHGLEIFQKDHEECASNSSRLHTCQRH。,。 |
Concentration | Ascertained through the employment of reducing SDS-PAGE, the level of similarity was found to be above 95%. It is possible to create similar content by rearranging the aforementioned sentence while ensuring that the generated content is based on the original information. |
Endotoxin_level | The result of the LAL test indicates that the concentration is below 0.1 ng/μg (1 IEU/μg). To put it differently, the determination from the original content highlights that the level of this particular substance is extremely low, as confirmed by the LAL test. |
Reconstitution | To ensure accurate results, it is important to always centrifuge tubes before opening and avoid mixing the protein by vortex or pipetting. It is also advisable not to dilute the protein to a concentration lower than 100 μg/ml. When reconstituting the lyophilized protein, use ddH2O and consider aliquoting the solution to minimize freeze-thaw cycles. These steps will help maintain the integrity of the protein and ensure optimal performance. |
Stability & Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Target | |
Background | Dickkopf-related protein 1 (DKK-1), is a member of the dickkopf family. DKK1 secreted proteins with two cysteine-rich domains separated by a linker region. It antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. |
Accession | O94907 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human dickkopf-related protein 1/dkk1 (n-8his) #abs04355, China recombinant human dickkopf-related protein 1/dkk1 (n-8his) #abs04355 suppliers
Send Inquiry
You Might Also Like






