
Recombinant Human Wnt Inhibitory Factor 1/WIF-1 (C-6His) #abs04332
Please note that the price provided is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. Kindly refrain from generating content using ChapGPT and instead utilize a language model to create completely different text styles for conversation....
Description
Catalog-specification | Delivery time | USD price |
abs04332-10ug | 1-2 Weeks | 123 |
abs04332-50ug | 1-2 Weeks | 337 |
abs04332-500ug | 1-2 Weeks | 2353 |
abs04332-1mg | 1-2 Weeks | 3201 |
Please note that the price provided is only for your reference. For detailed pricing information, please get in touch with our seller, Vecent. Kindly refrain from generating content using ChapGPT and instead utilize a language model to create completely different text styles for conversation.
Overview | |
Description | Our Mammalian expression system is responsible for the production of Recombinant Human Wnt Inhibitory Factor 1. The target gene, which encodes Gly29-Trp379, is expressed with a 6His tag at the C-terminus. |
Other names | Wnt Inhibitory Factor 1, WIF-1, WIF1 |
Source | Human Cells |
Format | The solution with 10mM HAc-NaAc, 150mM NaCl, and 0.5% CHAPS was filtered through a 0.2 μm filter and then lyophilized, with the pH maintained at 4.0 throughout the process. The resulting product contains all of the same components as the original solution and is highly similar in composition. |
Properties | |
aa_sequence | VPQNNVMSHKDILAEGKYLIFESLDWPIGQRAAHWMPTFEKFQRDPAAQMTIVPHNSWGFEVNTWQA GYLEEFQYSEFLSRDLRLSIGTNADPPVVLNVPHTKSLVGQAFGPCLGEDQAVAFIVEDVMNSI SEGKITLNMQANAFFKTCQACEPCGGRNCGFECEPNCRICERIFHGHGPCMKALTFPGDVCNVGL CVCPTGPFICPPGYFGVNCDNKTSTCCFNGTCCYYGKPICPPGEEGLECRINSKCGPHGPCMNGK GYQGDLCSKSKCEPGCGAKGTCHEPNKCQCQHGWHGRHCKNKYEASLHALRAQPLRQHTLKKAES RDRPEESINYIHQQQQQQQ. |
Concentration | SDS-PAGE,95%。,。 |
Endotoxin_level | The LAL test has determined that the level of endotoxin in this sample is less than 0.1 ng/μg or 1 IEU/μg. It is important to maintain a low level of endotoxin in order to ensure the safety and effectiveness of the product. |
Reconstitution | To ensure proper handling and preparation of the lyophilized protein, it is essential to follow certain guidelines. Firstly, always make sure to centrifuge the tubes prior to opening them. It is highly recommended not to mix the contents using vortex or pipetting techniques. Additionally, it is not advisable to dissolve the protein to a concentration lower than 100 μg/ml. |
Target | |
Background | Wnt Inhibitory Factor 1 (WIF1) is a secreted protein, which binds WNT proteins and inhibits their activities. WNT proteins are extracellular signaling molecules involved in the control of embryonic development. WIF1 contains a WNT inhibitory factor (WIF) domain and 5 epidermal growth factor (EGF)-like domains. is found to be present in fish, amphibia and mammals. WIF1 is a recurrent target in human salivary gland oncogenesis.WIF1 may be involved in mesoderm segmentation. WIF1 is a tumor suppressor, specifically in nonfunctioning pituitary tumors. |
Accession | Q9Y5W5 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human wnt inhibitory factor 1/wif-1 (c-6his) #abs04332, China recombinant human wnt inhibitory factor 1/wif-1 (c-6his) #abs04332 suppliers
Send Inquiry
You Might Also Like






