
Recombinant Human N-Acetylgalactosamine Kinase/GALK2 (C-6His) #abs04382
Please note that the price mentioned above is only for your reference. For the detailed price, kindly get in touch with our seller, Vecent. We would like to suggest that you generate a similar content by rephrasing the existing text, while ensuring that the information contained in the original...
Description
Catalog-specification | Delivery time | USD price |
abs04382-10ug | 1-2 Weeks | 230 |
abs04382-50ug | 1-2 Weeks | 673 |
abs04382-500ug | 1-2 Weeks | 2566 |
abs04382-1mg | 1-2 Weeks | 3491 |
Please note that the price mentioned above is only for your reference. For the detailed price, kindly get in touch with our seller, Vecent. We would like to suggest that you generate a similar content by rephrasing the existing text, while ensuring that the information contained in the original text is not altered. It is recommended to avoid using ChapGPT-generated content and instead opt for a completely different approach using the language model to generate text.
Overview | |
Description | Our Mammalian expression system is responsible for producing Recombinant Human Galactokinase 2, with a target gene encoding Met1-Ala458, that is expressed with a 6His tag at the C-terminus. We take pride in our cutting-edge technology that allows us to deliver high-quality recombinant proteins that are highly similar to their natural counterparts. With our advanced techniques, we are able to produce proteins that not only meet but exceed the expectations of our clients. Trust us to provide you with the best quality products on the market. |
Other names | GalNAc kinase, also called N-acetylgalactosamine kinase or Galactokinase 2, belongs to the GHMP kinase family and GalK subfamily. It is commonly referred to as GK2 or GALK2. |
Source | Human Cells |
Format | The solution provided is a filtered solution containing 20mM PB and 150mM NaCl, with a pH of 7.4. We can create a closely related sentence by rephrasing the same information in a different way: the pH-balanced solution is filtered through a 0.2 μm filter and contains 20mM of PB and 150mM of NaCl. |
Properties | |
aa_sequence | CSPVIYKGKPPIGRGAMFVMQDDSQNNLIAVHMAVSQETDPVLYPKFQLFEEQKSGIVQRLNLATTN VDGNSLSLCMSGTAVLNPLTVEFAGVYQSGKIYHNFSIIPRNDVLEFQAHINSEDGMIPLVKGLQ RNKITFDISLATCVGATNSNQEGLSTSPAAFLLLVLGTLCVQSLIKETLMAVSNRGIDESGGGMT FQAKEGALSTVLQSKAFAIPDVAELLECVNSNKNFAQSYIRMMVRLLAKVSECQDIGFNGICQAAE LSLVEWGMKHWTDZEKYFLPPSSEAPVVLFKKLYHQSAVRAEHYKSPIIKCVYLAILQFLHNNSA ALCPVHMLGQPKEDMKKTVRNSRTSMHLYFVYRNFKPLEAQGVGSCQPYICRRMELDVEKSGAGQ PRNLGSCWCGHMAVVFVSPTKSLKAYYQEDSVRAFGPLYKNLVLPDEHHLLEAAVACFLMGGLLKI。 |
Concentration | The level of similarity was found to be over 95% through the process of SDS-PAGE reduction. To produce a closely related content, the original text information was rearranged and expressed in different words. |
Endotoxin_level | 1 IEU/μg (less than 0.1 ng/μg) was detected through the LAL test. Let's produce a new content with the same information by rearranging the sentence structure and ensuring it remains consistent with the original text. |
Target | |
Background | GALK2 acts as a galactokinase when galactose is present at high concentrations. GALK2 may be involved in a salvage pathway for the reutilization of free GalNAc derived from the degradation of complex carbohydrates. GALK2 has been reported to participate in pathways, such as Amino sugar and nucleotide sugar metabolism, Galactose metabolism and Metabolic pathways. |
Accession | Q01415 |
This product is for research use only, not for use in diagnostic prodecures or in human.
Hot Tags: recombinant human n-acetylgalactosamine kinase/galk2 (c-6his) #abs04382, China recombinant human n-acetylgalactosamine kinase/galk2 (c-6his) #abs04382 suppliers
Send Inquiry
You Might Also Like






