Recombinant Cynomolgus TIM-3/HAVCR2 (C-Fc) #abs04638

Recombinant Cynomolgus TIM-3/HAVCR2 (C-Fc) #abs04638

Please note that the price provided is for reference only. For more details on pricing, please get in touch with our designated seller, Vecent. It's important to keep in mind that the information provided is based on the original text, but the generated content will be presented in a highly...

Description

Catalog-specification

Delivery time

USD price

abs04638-10ug

1-2 Weeks

146

abs04638-50ug

1-2 Weeks

382

abs04638-500ug

1-2 Weeks

2353

abs04638-1mg

1-2 Weeks

3201

Please note that the price provided is for reference only. For more details on pricing, please get in touch with our designated seller, Vecent. It's important to keep in mind that the information provided is based on the original text, but the generated content will be presented in a highly similar manner. Therefore, it's best to rely on the specific details our seller can provide.


Overview

Description

Our Mammalian expression system is utilized to produce Recombinant Cynomolgus T Cell Immunoglobulin and Mucin Domain-3. The target gene encoding Ser22-Arg201 is expressed with an Fc tag at the C-terminus. To generate a highly similar content based on the original text information, the following rearranged content is provided.

Other names

The molecule known as TIM-3, or T cell immunoglobulin and mucin domain 3, is also referred to as HAVCR2. It plays a significant role in immune responses and is involved in regulating T cell function. TIM-3 has emerged as an important target for immunotherapy due to its potential as a biomarker for various diseases. Researchers are investigating the therapeutic potential of targeting TIM-3 to enhance anti-tumor immune responses and prevent immune evasion.

Source

Mammalian cells

Format

The substance was dried through lyophilization after being filtered through a 0.2 μm filter and suspended in a pH7.4 phosphate-buffered saline solution. Can you please produce similar content without copying this original text too closely?

Properties

aa_sequence

AGKVPVNVLGNGAPPYWCPTVSYQNEAVEYGNSLDPGQPRFSKYGDVKSLTVIEADDLICVICR PGNMIKEDHVLKVNKIAKLARPTPSLQADRTLTFTLPGMESPAPTKVIVKALRTLSPNTDFA PRLTFEEGQHAPSTVPNSLTVDVDNLPFCFTLELQNDSTRSRIEITGKADMPCDTKHCCPCTP LGFLQPVVGPALLSPKDTMIPVEVSRVHDPEVEKFVTDGGVVNHAETKTPYTEGVRVTVSVLV LDWQIKKEYNGNLAGCKVPNKIATISKKPTIYRPQEVGQPKTAPPKPDLQLTNSVVCKVGFY DAWEVSNYNPPEQPTKTTKVGFDLVVSKLDTQNDSQGFLKSYFSLTWKDRESQGNVCSHEVAM SKPLSLSLYKQHTNHANPGTSKQDLSSPLV,。

Concentration

The purity of the sample was established to be over 95% through the process of SDS-PAGE gel electrophoresis. It was determined that the sample was highly homogeneous, with negligible impurities. To reiterate, the purity level of the sample was greater than 95%.

Endotoxin_level

The LAL test results showed that the levels of endotoxins are less than 0.1 ng/μg (equivalent to 1 International Endotoxin Unit per microgram). This information has been rearranged in a similar manner to convey the same message.

Reconstitution

To ensure proper handling of the samples, it is important to follow these guidelines. Before opening the tubes, always centrifuge them. Avoid mixing by vortex or pipetting as it may result in inaccurate results. It is strongly advised not to reconstitute the lyophilized protein to a concentration lower than 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. After reconstitution, it is recommended to divide the solution into smaller aliquots to minimize the number of freeze-thaw cycles. These steps will help maintain the quality and integrity of the samples.

Target

Background

T cell immunoglobulin and mucin domain 3 is a member of the TIM family of immune regulating molecules. Mature cynomolgus TIM3 consists of a 182 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 78 aa cytoplasmic tail. TIM3 is up-regulated on several populations of activated myeloid cells (macrophage, monocyte, dendritic cell, microglia, mast cell) and T cells (Th1, CD8+, NK, Treg). Its binding to Galectin9 induces a range of immunosuppressive functions which enhance immune tolerance and inhibit anti-tumor immunity. TIM3 ligation attenuates CD8+ and Th1 cell responses and promotes the activity of Treg and myeloid derived suppressor cells. TIM3 interactions with Galectin-9 can trigger immune stimulatory effects, such as the coactivation of NK cell cytotoxicity.

Accession

G7P6Q7


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant cynomolgus tim-3/havcr2 (c-fc) #abs04638, China recombinant cynomolgus tim-3/havcr2 (c-fc) #abs04638 suppliers

You Might Also Like

Shopping Bags