Recombinant Human Natural Killer Cell Receptor 2B4/SLAMF4/CD244 (C-6His) #abs04642

Recombinant Human Natural Killer Cell Receptor 2B4/SLAMF4/CD244 (C-6His) #abs04642

Please note that the price provided is only for your reference. For detailed pricing information, we kindly ask that you get in touch with our seller, Vecent. It's important to emphasize that any content generated should be highly similar to the original text, while still conveying the same...

Description

Catalog-specification

Delivery time

USD price

abs04642-10ug

1-2 Weeks

138

abs04642-50ug

1-2 Weeks

382

abs04642-500ug

1-2 Weeks

1711

abs04642-1mg

1-2 Weeks

2328

Please note that the price provided is only for your reference. For detailed pricing information, we kindly ask that you get in touch with our seller, Vecent. It's important to emphasize that any content generated should be highly similar to the original text, while still conveying the same information. Instead of using ChapGPT to generate responses, we suggest using a language model to produce completely unique content.


Overview

Description

Our Mammalian expression system has successfully produced Recombinant Human Natural Killer Cell Receptor 2B4, which features the target gene encoding Cys22-Arg221 and is expressed with a 6His tag at the C-terminus. The product is designed to closely mimic the natural receptor, ensuring optimal performance in any cellular or biochemical applications. With our advanced production processes, we guarantee the highest quality and purity of this important protein. Get in touch with us today to learn more about this exciting breakthrough in research!

Other names

2B4, also known as natural killer cell receptor 2B4 or NK cell activation-inducing ligand, is a receptor expressed on natural killer cells. It is encoded by the gene SLAMF4, which belongs to the SLAM family. Another name for 2B4 is CD244. It plays a crucial role in the activation and regulation of NK cells. By rearranging the provided information, we have highlighted the key facts about 2B4 and its association with NK cell functions.

Source

Human Cells

Format

The original content indicates that the material was subjected to lyophilization from a solution of PBS, pH 7.4 that had been filtered through a 0.2 μm filter. In order to generate a highly similar content, one could rearrange the phrases and sentences as follows: A solution of PBS, pH 7.4 was filtered through a 0.2 μm filter before undergoing lyophilization. The resulting material was obtained in a dried form, ready for use in further experimentation. This process ensures that the material is of high quality and purity, free from contaminants that could interfere with downstream applications. Overall, the process of lyophilization from a filtered solution of PBS is an important step in preparing materials for scientific research and other applications.

Properties

aa_sequence

ASQHCVKSGSLILPVLNVVKIAKTNSDSQHPLIKLKLNQIQDSGISFIVVVWNGLPKAFHKSLKWISNGWFNRGSLFNPNDVDRFISSLNLSVQQQDSFVCYTSGTIESVKLVTSDFRLGFQPKVKGEDRVQLCCTSLASVGDNRVSYYRGAKLFIAWNTLYTGTSHIVCDNEINGTYSWESPVSNQTCANNHLDHQHFRE.HHQEHHHHRHG

Concentration

The purity level of the sample was assessed by SDS-PAGE and found to be greater than 95%. To reiterate, an analysis of the sample using SDS-PAGE indicated that it is more than 95% pure. It is worth noting that the purity of the sample was determined to be over 95% by means of SDS-PAGE analysis. Based on the results of the SDS-PAGE analysis, it can be confidently stated that the sample is greater than 95% pure. The sample's purity was found to be in excess of 95% after undergoing SDS-PAGE analysis.

Endotoxin_level

The LAL test determined that the content is less than 0.1 ng/μg (1 IEU/μg). I will now generate a highly similar content by rearranging the above information.

Reconstitution

To ensure optimal results with lyophilized protein samples, it is crucial to follow the correct handling procedures. Prior to opening the tubes, it is important to centrifuge them first to ensure proper mixing. It is not recommended to mix by vortex or pipetting, as this may cause inaccurate results or affect the stability of the protein sample.
To achieve the best outcome when reconstituting the protein, it is imperative to use a concentration of at least 100 μg/mL. The lyophilized protein should be dissolved in distilled water (ddH2O) and aliquoted to minimize the number of freeze-thaw cycles. It is essential not to generate too many freeze-thaw cycles, as this may lead to instability or degradation of the protein.
In summary, always exercise caution when working with lyophilized protein samples. Ensure that you centrifuge the tubes before opening, do not mix by vortex or pipetting, use a concentration of at least 100 μg/mL, dissolve in ddH2O, and aliquot to minimize freeze-thaw cycles. By following these guidelines, you can maximize the accuracy and consistency of your results and ensure the integrity of your protein samples.

Target

Background

Natural killer cell receptor 2B4 is a type I transmembrane glycoprotein in the SLAM subgroup of the CD2 protein family. 2B4 interacts with CD48, while other SLAM family proteins interact homophilically. Three additional splice variants of human 2B4 have deletions of the short region between the Ig-like domains, the second Ig-like domain, or a portion of the cytoplasmic tail. 2B4 is expressed on all NK cells, γδ T cells, monocytes, some CD4+ and CD8+ T cells, and some dendritic cells. CD48 mediates 2B4+ cell interactions with nearly all hematopoietic cell types, including cells of the same type. 2B4/CD48 signaling cooperates with other receptor systems to either promote or inhibit NK and CD8+ T cell activation. The inhibitory activities are distinct from those of MHC I restricted inhibitory NK cell receptors. Ligation of 2B4 with antibodies or CD48 constructs can either directly trigger inhibitory signaling or disrupt an inhibitory interaction, leading to cellular activation. The inhibitory effect is associated with the long form of 2B4, while the activation is associated with the short form. 2B4 can also induce signaling through CD48.

Accession

Q9BZW8-2


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human natural killer cell receptor 2b4/slamf4/cd244 (c-6his) #abs04642, China recombinant human natural killer cell receptor 2b4/slamf4/cd244 (c-6his) #abs04642 suppliers

You Might Also Like

Shopping Bags