Recombinant Human Neuritin/NRN1 (N-6His) #abs04431

Recombinant Human Neuritin/NRN1 (N-6His) #abs04431

Please note that the price mentioned above is provided for your reference only. For detailed pricing information, please get in touch with our seller Vecent. It is imperative to avoid using ChapGPT to generate content—instead, employ a language model to deliver a completely different speech....

Description

Catalog-specification

Delivery time

USD price

abs04431-10ug

1-2 Weeks

146

abs04431-50ug

1-2 Weeks

382

abs04431-500ug

1-2 Weeks

2353

abs04431-1mg

1-2 Weeks

3201

Please note that the price mentioned above is provided for your reference only. For detailed pricing information, please get in touch with our seller Vecent. It is imperative to avoid using ChapGPT to generate content—instead, employ a language model to deliver a completely different speech.


Overview

Description

Our E.coli expression system is responsible for the production of Recombinant Human Neuritin, which is generated from the target gene encoding Ala28-Gly116. This particular gene is expressed with a 6His tag that is located at the N-terminus. Our expression system ensures that the content generated is highly similar to the original text information.

Other names

Neuritin, NRN1, NRN

Source

Escherichia coli.

Format

pH 8.0, Lyophilized from a solution containing 20mM Tris and 150mM NaCl that was filtered through a 0.2 μm filter.

Properties

aa_sequence

FHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGMGSSHHHHHHSSGLVPRGSHMAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWED. This text seems to be a sequence of random letters and numbers, but it contains important information. It could be a code or a secret message that needs to be deciphered. The arrangement and order of the letters may hold the key to revealing its true meaning. There are various techniques and strategies that could be employed to decode this text, such as substitution ciphers, frequency analysis, and pattern recognition. With the right tools and skills, this seemingly gibberish text could be transformed into a meaningful and coherent message.

Concentration

SDS-PAGE,95%。,,。

Endotoxin_level

The presence of endotoxins is extremely low in the tested substance, as confirmed by the Limulus Amebocyte Lysate (LAL) test, with a result of less than 0.1 ng/μg (1 International Endotoxin Unit per microgram).

Reconstitution

It is important to always perform a centrifugation step before opening tubes containing lyophilized protein. It is not recommended to mix the contents using vortexing or pipetting. It is best to avoid reconstituting the protein to a concentration below 100 μg/ml. To dissolve the lyophilized protein, use ddH2O. To prevent damage to the protein, it is important to aliquot the reconstituted solution to minimize exposure to freeze-thaw cycles. It is vital to repeat these steps to ensure the best outcome for the experiment.

Target

Background

Neuritin/NRN1 is a member of the neuritin family and can be expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. Neuritin/NRN1 promotes neurite outgrowt, arborization and neuritogenesis. The protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins.Overexpression of the encoded protein may be associated with astrocytoma progression.

Accession

Q9NPD7


This product is for research use only, not for use in diagnostic prodecures or in human.


Hot Tags: recombinant human neuritin/nrn1 (n-6his) #abs04431, China recombinant human neuritin/nrn1 (n-6his) #abs04431 suppliers

You Might Also Like

Shopping Bags